DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2767 and Akr1a1

Sequence 1:NP_649757.1 Gene:CG2767 FlyBaseID:FBgn0037537 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_067448.1 Gene:Akr1a1 MGIID:1929955 Length:325 Species:Mus musculus

Alignment Length:325 Identity:140/326 (43%)
Similarity:201/326 (62%) Gaps:15/326 (5%)


  Fly    10 NNGEKMPVIGIGTWQASDEEIETAIDAALEAGYRHIDTAPVYGNEKAIGRVLKRWLDAGK-VKRE 73
            :.|:|||:||:|||::...:::.||..||.|||||||.|.|||||..||..||..:.:|| |.||
Mouse     9 HTGQKMPLIGLGTWKSEPGQVKAAIKHALSAGYRHIDCASVYGNETEIGEALKESVGSGKAVPRE 73

  Fly    74 ELFIVTKVPPVSNRPHEVEPTIKKSLEDLQLDYVDLYLVHTPFTININEDGSFKLDKEGLMEVDV 138
            |||:.:|:....:.|.:|||.::|:|.||||:|:||||:|.|:... ..|..|..:.:|.:..| 
Mouse    74 ELFVTSKLWNTKHHPEDVEPALRKTLADLQLEYLDLYLMHWPYAFE-RGDNPFPKNADGTVRYD- 136

  Fly   139 TTNHAAIWVAMEALVEKGLTKSIGVSNFSKDQVARLLKNCKIRPANNQIEHHVYLQQRDLVDFCK 203
            :|::...|.|:|.||.|||.|::|:|||:..|:..:|....:|||..|:|.|.||.|.:|:..|.
Mouse   137 STHYKETWKALEVLVAKGLVKALGLSNFNSRQIDDVLSVASVRPAVLQVECHPYLAQNELIAHCH 201

  Fly   204 SENITVTAYSPLGSKGIAKFNAGAGIVRDLPDLMDIPEVKEIAASHGKTPAQVLLRWIIDTGVSA 268
            :..:.|||||||||...|..:.      |.|.|::.|.|..:|..||::|||:||||.:...|..
Mouse   202 ARGLEVTAYSPLGSSDRAWRHP------DEPVLLEEPVVLALAEKHGRSPAQILLRWQVQRKVIC 260

  Fly   269 IPKSTNPARLKQNLDVFDFELTAEEVAKLSSLDQNIR-ICDFAFFHG--VER---HPEFTFKNQY 327
            ||||.||:|:.||:.||||..:.||:.:|.:|::|.| |.......|  |.|   ||.:.|.:.|
Mouse   261 IPKSINPSRILQNIQVFDFTFSPEEMKQLDALNKNWRYIVPMITVDGKRVPRDAGHPLYPFNDPY 325

  Fly   328  327
            Mouse   326  325

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2767NP_649757.1 ARA1 5..302 CDD:223729 130/293 (44%)
Tas 10..297 CDD:223739 128/288 (44%)
Akr1a1NP_067448.1 ARA1 1..303 CDD:223729 133/302 (44%)
Tas 9..291 CDD:223739 129/290 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1016440at2759
OrthoFinder 1 1.000 FOG0000053
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1770
TreeFam 1 0.960
54.900

Return to query results.
Submit another query.