DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2767 and kcnab2b

Sequence 1:NP_649757.1 Gene:CG2767 FlyBaseID:FBgn0037537 Length:329 Species:Drosophila melanogaster
Sequence 2:XP_005162233.1 Gene:kcnab2b ZFINID:ZDB-GENE-080219-36 Length:469 Species:Danio rerio

Alignment Length:340 Identity:85/341 (25%)
Similarity:142/341 (42%) Gaps:75/341 (22%)


  Fly    11 NGEKMPVIGIGTW-----QASDEEIETAIDAALEAGYRHIDTAPVYGNEKA---IGRVLKR--WL 65
            :|.::..:|:|||     |.:||..|..:..|.|.|....|||.||...||   :|.::|:  | 
Zfish   132 SGLRVSCLGLGTWVTFGGQITDEIAEQLMTLAYENGINLFDTAEVYAAGKAEMVLGSIIKKKGW- 195

  Fly    66 DAGKVKREELFIVTKV--------PPVSNRPHEVEPTIKKSLEDLQLDYVDLYLVHTPFTININE 122
                 :|..|.|.||:        ....:|.|.:| .::.|||.|||:|||:...:.|......|
Zfish   196 -----RRSSLVITTKIYWGGKAETERGLSRKHIIE-GLRASLERLQLEYVDVVFANRPDPNTPME 254

  Fly   123 DGSFKLDKEGLMEVDVTTNHAAIWVAMEALVEKGLTKSIGVSNFSKDQVARLLKNCK----IRPA 183
            ...|...|.....::.|..      ||..::.:|:....|.|.:|..::.......:    |.|.
Zfish   255 GDPFNTSKSRTFIIEETVR------AMTHVINQGMAMYWGTSRWSSMEIMEAYSVARQFNLIPPV 313

  Fly   184 NNQIEHHVYLQQRDLVDFCKSE-----NITVTAYSPLGSKGI--AKFNAGA-----GIVRDLPDL 236
            ..|.|:|::  ||:.|:....|     .:....:|||.. ||  .|:::|.     ..::....:
Zfish   314 CEQAEYHMF--QREKVEVQLPELFHKIGVGAMTWSPLAC-GIISGKYDSGVPPCSRASLKGYQWM 375

  Fly   237 MD-------------IPEVKEIAASHGKTPAQVLLRWII-DTGVSAI---PKSTNPARLKQNLDV 284
            .|             :.|::.||...|.|..|:.:.|.: :.|||.:   ..||:  :|.:|:..
Zfish   376 KDKILSEEGRRQQAKLKELQAIAERLGCTLPQLAIAWCLRNEGVSCVLLGASSTD--QLMENIGA 438

  Fly   285 FDFELTAEEVAKLSS 299
            .      :.:.||||
Zfish   439 I------QVLPKLSS 447

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2767NP_649757.1 ARA1 5..302 CDD:223729 85/341 (25%)
Tas 10..297 CDD:223739 82/337 (24%)
kcnab2bXP_005162233.1 Kv_beta 126..457 CDD:213602 85/341 (25%)
Aldo_ket_red 126..456 CDD:119408 85/341 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.