DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2767 and akr1b1.2

Sequence 1:NP_649757.1 Gene:CG2767 FlyBaseID:FBgn0037537 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_001070715.1 Gene:akr1b1.2 ZFINID:ZDB-GENE-041210-132 Length:316 Species:Danio rerio

Alignment Length:328 Identity:138/329 (42%)
Similarity:197/329 (60%) Gaps:17/329 (5%)


  Fly     4 TKFLTFNNGEKMPVIGIGTWQASDEEIETAIDAALEAGYRHIDTAPVYGNEKAIGRVLKRWLDAG 68
            :|.:..|.|..||::|:|||::...::..|:.||:.|||||||.|.||.||..:|..:|..:..|
Zfish     2 SKSVKLNTGADMPILGLGTWKSPPGKVAEAVKAAIAAGYRHIDGAAVYNNETEVGEGIKAMIKDG 66

  Fly    69 KVKREELFIVTKVPPVSNRPHEVEPTIKKSLEDLQLDYVDLYLVHTPFTININEDGSFKLDKEGL 133
            .|||||||:|:|:....:....|:...:|:|.||.|||:||||:|.|.......: .|.||.|||
Zfish    67 VVKREELFVVSKLWCTFHEKALVKGACQKTLSDLNLDYLDLYLIHWPMGFKSGSE-QFPLDSEGL 130

  Fly   134 MEVDVTTNHAAIWVAMEALVEKGLTKSIGVSNFSKDQVARLLK--NCKIRPANNQIEHHVYLQQR 196
            ...| .::....|..||.||:.||.|:||:|||:::|:..:|.  ..|.:|||||:|.|.||.|.
Zfish   131 TIGD-DSSFLDTWEGMEELVDAGLVKAIGISNFNREQIEAILNKPGLKYKPANNQVECHPYLTQD 194

  Fly   197 DLVDFCKSENITVTAYSPLGS--KGIAKFNAGAGIVRDLPDLMDIPEVKEIAASHGKTPAQVLLR 259
            .|:.:|:|:.|||||||||||  :..||        .:.|.|:|.|.:|.||..|.||.||||:|
Zfish   195 KLISYCQSKGITVTAYSPLGSPDRPWAK--------PEDPSLLDDPNIKAIAEKHKKTTAQVLIR 251

  Fly   260 WIIDTGVSAIPKSTNPARLKQNLDVFDFELTAEEVAKLSSLDQNIRICDFAFFHGVERHPEFTFK 324
            :.|...|..||||..|.|:::|..||||||:.|::..:.|.::|.|.|.   .|...:|.::.|.
Zfish   252 FQIQRNVIVIPKSITPQRIQENFQVFDFELSEEDMKTILSFNRNFRACP---MHWGVKHRDYPFN 313

  Fly   325 NQY 327
            .:|
Zfish   314 AEY 316

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2767NP_649757.1 ARA1 5..302 CDD:223729 131/301 (44%)
Tas 10..297 CDD:223739 129/291 (44%)
akr1b1.2NP_001070715.1 ARA1 1..306 CDD:223729 135/317 (43%)
Tas 8..289 CDD:223739 129/291 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1016440at2759
OrthoFinder 1 1.000 FOG0000053
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR11732
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1770
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
55.040

Return to query results.
Submit another query.