DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2767 and zgc:110366

Sequence 1:NP_649757.1 Gene:CG2767 FlyBaseID:FBgn0037537 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_001278275.1 Gene:zgc:110366 ZFINID:ZDB-GENE-050417-302 Length:291 Species:Danio rerio

Alignment Length:303 Identity:107/304 (35%)
Similarity:160/304 (53%) Gaps:36/304 (12%)


  Fly    10 NNGEKMPVIGIGTWQASDEEIETAIDAALEAGYRHIDTAPVYGNEKAIGRVLKRWLDAGKVKREE 74
            :||..:|::|:||........|..:.|..|.|.||||||..||.|:|:|:.:   .::| |:|||
Zfish    19 HNGLNIPILGLGTSHYGGYSHEAVLYALQECGIRHIDTAKRYGCEEALGKAV---TESG-VQREE 79

  Fly    75 LFIVTKVPPVSNRPHEVEPTIKKSLEDLQLDYVDLYLVHTPFTININEDGSFKLDKEGLMEVDVT 139
            |:|.||:.|........:...:.|...|.:||:||||:|.|.::         :......||.:.
Zfish    80 LWITTKLWPGDYGYQSTKQACRDSCARLGVDYLDLYLMHWPDSM---------VPGRSSQEVRLE 135

  Fly   140 TNHAAIWVAMEALVEKGLTKSIGVSNFSKDQVARLLKNC-KIRPANNQIEHHVYLQQRDLVDFCK 203
            |     |.|:|.|.::||.::||||||....:.. ||:| .|.|..||:|.|.:.|...||:.|:
Zfish   136 T-----WRALEELYDEGLCRAIGVSNFLIPHLNE-LKDCGGIVPHVNQVEFHPFQQPMKLVEHCR 194

  Fly   204 SENITVTAYSPLGSKGIAKFNAGAGIVRDLPDLMDIPEVKEIAASHGKTPAQVLLRWIIDTGVSA 268
            .|||....|.|| :||.|               :..|.:.|:|..:|::.:|:.:||.|..||..
Zfish   195 KENIVFEGYCPL-AKGQA---------------LTHPHILELAKKYGRSASQICIRWSIQNGVVT 243

  Fly   269 IPKSTNPARLKQNLDVFDFELTAEEVAKLSSLDQNIRICDFAF 311
            |||||.|.|:.:|..||.|.||:|::|.:|.|..|.::....|
Zfish   244 IPKSTKPDRIYENCQVFGFTLTSEDMAYISDLHTNQKLIHLTF 286

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2767NP_649757.1 ARA1 5..302 CDD:223729 105/293 (36%)
Tas 10..297 CDD:223739 103/288 (36%)
zgc:110366NP_001278275.1 ARA1 16..277 CDD:223729 105/293 (36%)
Tas 19..276 CDD:223739 105/292 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.