DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2767 and 9030611n15rik

Sequence 1:NP_649757.1 Gene:CG2767 FlyBaseID:FBgn0037537 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_001015685.1 Gene:9030611n15rik ID: Length:324 Species:Xenopus tropicalis

Alignment Length:326 Identity:122/327 (37%)
Similarity:192/327 (59%) Gaps:15/327 (5%)


  Fly     7 LTFNNGEKMPVIGIGTW--QASDEEI-ETAIDAALEAGYRHIDTAPVYGNEKAIGRVLKRWLDAG 68
            :..::|.||||||.||:  :.|.:.: |.....|::.||||||.|.:||||..:||.::..:..|
 Frog     9 VALSDGHKMPVIGFGTYAPEKSPKHLAEEGTKVAIDVGYRHIDCAFIYGNEVEVGRAIRAKIADG 73

  Fly    69 KVKREELFIVTKVPPVSNRPHEVEPTIKKSLEDLQLDYVDLYLVHTPFTININEDGSFKLDKEGL 133
            .||||::|...|:....:.|..|...::|||:||||||:||:::|.|..:...:| ...||:.|.
 Frog    74 TVKREDVFYTGKLWSTFHTPERVRVCLEKSLKDLQLDYMDLFIIHEPIELKPGDD-PLPLDENGK 137

  Fly   134 MEVDVTTNHAAIWVAMEALVEKGLTKSIGVSNFSKDQVARLLK--NCKIRPANNQIEHHVYLQQR 196
            : :...|:....|.|:|...:.||.:|||||||:..|:..:|.  ..|.:|..||:|.||||.|.
 Frog   138 L-IYHNTDIRDTWKALEKCKDAGLVRSIGVSNFNHKQLELILNMPGLKYKPVCNQVECHVYLNQS 201

  Fly   197 DLVDFCKSENITVTAYSPLGSKGIAKFNAGAGIVRDLPDLMDIPEVKEIAASHGKTPAQVLLRWI 261
            .|::||||::|.:..||.|||....::     :.::.|.|::.|.:..||....:||.||.:|::
 Frog   202 KLLEFCKSKDIVLVGYSVLGSSRDEQW-----VDQNSPVLLEDPVLNRIAKKLNRTPTQVAMRYL 261

  Fly   262 IDTGVSAIPKSTNPARLKQNLDVFDFELTAEEVAKLSSLDQNIRICDFAFFHGVERHPEFTFKNQ 326
            :..||..:.||..|||::||..||||:|.||::..|..|::|:|..|...:   ..||::.|..:
 Frog   262 LQRGVVILAKSFTPARIQQNFKVFDFKLDAEDMKSLDGLNRNLRYVDATKW---SDHPKYPFHEE 323

  Fly   327 Y 327
            |
 Frog   324 Y 324

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2767NP_649757.1 ARA1 5..302 CDD:223729 115/300 (38%)
Tas 10..297 CDD:223739 113/292 (39%)
9030611n15rikNP_001015685.1 ARA1 8..307 CDD:223729 117/305 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000053
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.