DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2767 and akr1c4

Sequence 1:NP_649757.1 Gene:CG2767 FlyBaseID:FBgn0037537 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_001011079.1 Gene:akr1c4 XenbaseID:XB-GENE-5895888 Length:320 Species:Xenopus tropicalis

Alignment Length:327 Identity:127/328 (39%)
Similarity:201/328 (61%) Gaps:21/328 (6%)


  Fly     7 LTFNNGEKMPVIGIGTWQASDEEIETAIDA---ALEAGYRHIDTAPVYGNEKAIGRVLKRWLDAG 68
            ||.::|..:||:|:||:.:::.......:|   |::.||||||.|.:||||..||..::..:..|
 Frog     9 LTLHDGNAIPVMGLGTYASAEVPKSDGTEATKLAIDLGYRHIDCAYIYGNEVQIGEAIRSKIADG 73

  Fly    69 KVKREELFIVTKVPPVSNRPHEVEPTIKKSLEDLQLDYVDLYLVHTPFTININEDGSFK-LDKEG 132
            .|||||:|...|:......|:.|...::.||:.|||||:||:::|.||::..::..|.: ||.: 
 Frog    74 TVKREEIFYTGKLWCSFFSPNLVRQGLEASLKALQLDYLDLFIMHWPFSVKPSDAHSNQPLDFD- 137

  Fly   133 LMEVDVTTNHAAIWVAMEALVEKGLTKSIGVSNFSKDQVARLLK--NCKIRPANNQIEHHVYLQQ 195
              :||    ....|.|:|...:.||.||||||||::.|:.|||.  ..|.:|..||:|:||||.|
 Frog   138 --DVD----FCLTWEALEGCKDAGLVKSIGVSNFNRRQLERLLNKPGLKYKPVCNQVEYHVYLNQ 196

  Fly   196 RDLVDFCKSENITVTAYSPLGSKGIAKFNAGAGIVRDLPDLMDIPEVKEIAASHGKTPAQVLLRW 260
            ..|.::||..||.:.|||.||:   |:.|  ..:..:.|.|::.|.::.:||.:.::||:|.:|:
 Frog   197 SKLHEYCKCHNIVLVAYSVLGT---ARDN--TWVDPNSPVLLEDPVLRSVAAKYNRSPAEVAMRF 256

  Fly   261 IIDTGVSAIPKSTNPARLKQNLDVFDFELTAEEVAKLSSLDQNIRICDFAFFHGVERHPEFTFKN 325
            |:..|...:.||.||.||||||.||:|||..|::..|..|::|:|   :|.|..:::|||:.|.:
 Frog   257 ILQKGAVVLAKSFNPTRLKQNLGVFEFELKPEDMEMLDGLNRNLR---YAQFTVMKQHPEYPFHD 318

  Fly   326 QY 327
            :|
 Frog   319 EY 320

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2767NP_649757.1 ARA1 5..302 CDD:223729 118/301 (39%)
Tas 10..297 CDD:223739 114/293 (39%)
akr1c4NP_001011079.1 ARA1 7..302 CDD:223729 120/308 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1016440at2759
OrthoFinder 1 1.000 FOG0000053
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.