DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2767 and zgc:101765

Sequence 1:NP_649757.1 Gene:CG2767 FlyBaseID:FBgn0037537 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_001006056.1 Gene:zgc:101765 ZFINID:ZDB-GENE-041010-156 Length:288 Species:Danio rerio

Alignment Length:301 Identity:115/302 (38%)
Similarity:170/302 (56%) Gaps:33/302 (11%)


  Fly    10 NNGEKMPVIGIGTWQ-ASDEEIETAIDAALEAGYRHIDTAPVYGNEKAIGRVLKRWLDAGKVKRE 73
            ||..:||::|:||:: ...|:..:|:||||:||||..|||.||.||..:|..|:..|....:.||
Zfish    11 NNDIQMPLLGLGTFRLQGQEDTYSAVDAALKAGYRAFDTAAVYRNEAHLGHALRCLLPKHGLSRE 75

  Fly    74 ELFIVTKVPPVSNRPHEVEPTIKKSLEDLQLDYVDLYLVHTPFTININEDGSFKLDKEGLMEVDV 138
            ::||.:|:.| .::..:.....:||||.|.|.|:||||:|.|.|             :||...|.
Zfish    76 DVFITSKLGP-KDQGSKARNGCQKSLEQLGLGYIDLYLIHWPGT-------------QGLPVGDK 126

  Fly   139 TT--NHAAIWVAMEALVEKGLTKSIGVSNFSKDQVARLLKNCKIRPANNQIEHHVYLQQRDLVDF 201
            ..  |.|..|..:|....:|..::|||||::.:.:..|||:||:.||..|:|.|..|.|.||...
Zfish   127 RNPENRAQSWRVLEEFYSEGKFRAIGVSNYTVEHMQELLKSCKVPPAVLQVEFHPKLLQNDLRGL 191

  Fly   202 CKSENITVTAYSPLGSKGIAKFNAGAGIVRDLPDLMDIPEVKEIAASHGKTPAQVLLRWIIDTGV 266
            ||...:...|||.||:          |:      |:..|.|.|||...|:|||||||||.:...:
Zfish   192 CKIRGVCFQAYSSLGT----------GL------LLSNPVVLEIAKECGRTPAQVLLRWAVQQSI 240

  Fly   267 SAIPKSTNPARLKQNLDVFDFELTAEEVAKLSSLDQNIRIC 307
            :.:|||:.|.|:|:|..:||||::.|::.:||:||...:.|
Zfish   241 AVLPKSSQPERVKENGRLFDFEISEEDMERLSALDCGEKFC 281

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2767NP_649757.1 ARA1 5..302 CDD:223729 114/295 (39%)
Tas 10..297 CDD:223739 110/290 (38%)
zgc:101765NP_001006056.1 ARA1 5..283 CDD:223729 115/302 (38%)
Tas 11..271 CDD:223739 110/290 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1770
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.