DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2767 and akr7a2

DIOPT Version :9

Sequence 1:NP_649757.1 Gene:CG2767 / 40946 FlyBaseID:FBgn0037537 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_001034821.1 Gene:akr7a2 / 447982 XenbaseID:XB-GENE-996153 Length:348 Species:Xenopus tropicalis


Alignment Length:316 Identity:73/316 - (23%)
Similarity:122/316 - (38%) Gaps:76/316 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 KMPVIGIGTWQ---ASDEEI--ETAIDAALEAGYRHIDTAPVYGNEKAIGRVLKRWLDAGKVKRE 73
            ::|...:||.:   ..||:.  ||..| .|..|:..:|||.:|. |....|:|.|.....:||  
 Frog    30 QLPGTVLGTMEFGRRMDEKCSGETVRD-FLRRGHEELDTALMYA-EGETERILGRMELGSQVK-- 90

  Fly    74 ELFIVTKVPPVSN---RPHEVEPTIKKSLEDLQLDYVDLYLVHTPFTININEDGSFKLDKEGLME 135
               :.||..|...   :|..|...::|||:.||...|.|:.:|.|               :....
 Frog    91 ---MATKANPWGGNTLKPESVRQQLEKSLQQLQTPSVHLFYLHAP---------------DHQTP 137

  Fly   136 VDVTTNHAAIWVAMEALVEKGLTKSIGVSNFSKDQVARLLKNCKIR----PANNQIEHHVYLQQ- 195
            |:.|..      |.:.|.::|..|.:|:||::..:|..:...||.|    |...|..::...:| 
 Frog   138 VEETLG------ACQQLYQEGKFKELGLSNYAAWEVMEIYCICKQRNWVLPTVYQGMYNATTRQV 196

  Fly   196 -RDLVDFCKSENITVTAYSPLGS---KGIAKF--------------NAGAGIVR---------DL 233
             .:|:...:...:...||:||..   .|..|:              |:.|.:.|         |.
 Frog   197 ETELLPCLRQLGMRFYAYNPLAGGLLTGRYKYEDKEKEQASCRFFGNSWAEVYRNRYWKKHHFDA 261

  Fly   234 PDLMDIPEVKEIAASHGKTPAQVLLRWII-------DTGVSAIPKSTNPARLKQNL 282
            .||:. ..::|...|...:.....|||:.       ..|.:.|...::..:.|||:
 Frog   262 IDLVQ-NSLQEAYGSERPSLTSAALRWMYHHSKLQGSLGDAVILGMSSTEQYKQNM 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2767NP_649757.1 ARA1 5..302 CDD:223729 73/316 (23%)
Tas 10..297 CDD:223739 73/316 (23%)
akr7a2NP_001034821.1 Tas 36..344 CDD:223739 72/310 (23%)
Aldo_ket_red 36..335 CDD:119408 72/310 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.