DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2767 and akr1a1a

Sequence 1:NP_649757.1 Gene:CG2767 FlyBaseID:FBgn0037537 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_001003783.1 Gene:akr1a1a ZFINID:ZDB-GENE-040808-44 Length:324 Species:Danio rerio

Alignment Length:338 Identity:134/339 (40%)
Similarity:198/339 (58%) Gaps:29/339 (9%)


  Fly     4 TKFLTFNNGEKMPVIGIGTWQASDEEIETAIDAALEAGYRHIDTAPVYGNEKAIGRVLKRWLDAG 68
            |..:|.:.|::||.:|:|||:::..:::.|:.|||:.||||||.|..|.||:.:|..|...|..|
Zfish     2 TATITLSTGQRMPTVGLGTWKSAPGQVKQAVLAALDCGYRHIDCAAAYSNEREVGEALTERLGPG 66

  Fly    69 K-VKREELFIVTKVPPVSNRPHEVEPTIKKSLEDLQLDYVDLYLVHTPFT-------ININEDGS 125
            | ::|:::|:.:|:....:.|.:||...::||.||:|.|:||||:|.|..       |..:.||:
Zfish    67 KSLRRDDIFVTSKLWNTKHHPDDVEEACRRSLSDLRLSYLDLYLIHWPMAFGRGDELIPRHPDGT 131

  Fly   126 FKLDKEGLMEVDVTTNHAAIWVAMEALVEKGLTKSIGVSNFSKDQVARLLKNCKIRPANNQIEHH 190
            .:.|         .|::...|.|||.||::||.|:||:|||:..|:..:|...|.:|..||:|.|
Zfish   132 IQYD---------DTHYRDTWAAMEKLVDQGLAKAIGLSNFNAKQIDDILSIAKHKPVVNQVECH 187

  Fly   191 VYLQQRDLVDFCKSENITVTAYSPLGSKGIAKFNAGAGIVRDLPDLMDIPEVKEIAASHGKTPAQ 255
            .||.|.:|...|.|.|:||||||||||........|..:      |:|.|.|..||.|:.|||||
Zfish   188 PYLVQAELASHCWSRNLTVTAYSPLGSPDRPWVTPGEAL------LLDDPRVVGIAKSYNKTPAQ 246

  Fly   256 VLLRWIIDTGVSAIPKSTNPARLKQNLDVFDFELTAEEVAKLSSLDQNIR-ICDFAFFHGVE--- 316
            |::||.|..||..||||..|:|:|||::||||:|:.|::..:.|.::|.| |.......|.:   
Zfish   247 VIIRWHIQRGVVCIPKSVTPSRIKQNIEVFDFKLSDEDMRLIESFNRNERFIIPTVIKDGQKVWR 311

  Fly   317 --RHPEFTFKNQY 327
              .||.|.|...|
Zfish   312 DANHPHFPFIEPY 324

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2767NP_649757.1 ARA1 5..302 CDD:223729 124/305 (41%)
Tas 10..297 CDD:223739 122/295 (41%)
akr1a1aNP_001003783.1 ARA1 1..297 CDD:223729 127/310 (41%)
Tas 14..300 CDD:223739 124/301 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1016440at2759
OrthoFinder 1 1.000 FOG0000053
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1770
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
54.900

Return to query results.
Submit another query.