DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2767 and akr7a3

DIOPT Version :9

Sequence 1:NP_649757.1 Gene:CG2767 / 40946 FlyBaseID:FBgn0037537 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_001002369.1 Gene:akr7a3 / 436642 ZFINID:ZDB-GENE-040718-62 Length:323 Species:Danio rerio


Alignment Length:357 Identity:79/357 - (22%)
Similarity:129/357 - (36%) Gaps:97/357 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 NGEKMPVIGIGTW----QASDEEIETAIDAALEAGYRHIDTAPVYGNEKAIGRVLKRWLDAGKVK 71
            :|..:||..:||.    :|........:...||.|:..:|||.:|.:.:|...:....|.     
Zfish     2 SGSSIPVTLLGTMAFGGRADAHMSSQLVRVFLERGHSELDTALMYNDGQAESIIGDMQLP----- 61

  Fly    72 REELFIVTKVPPVSN---RPHEVEPTIKKSLEDLQLDYVDLYLVHTPFTININED---GSFKLDK 130
             |.:.|.||..|...   :|..|...::.||:.|:...|.::.:|.|...|..:|   ...:|.|
Zfish    62 -ETVRIATKANPWEGKTLKPDSVRKQLESSLKRLRRQTVQIFYLHAPDHQNPIQDTLQACNQLHK 125

  Fly   131 EGLMEVDVTTNHAAIWVAMEALVEKGLTKSIGVSNFSKDQVARLLKNCKIRPANNQIEHHVY--- 192
            ||..|                        .:|:||::..:||.:...||   .||.:...||   
Zfish   126 EGKFE------------------------ELGLSNYASWEVAEIYSICK---HNNWVLPTVYQGM 163

  Fly   193 ------LQQRDLVDFCKSENITVTAYSPL---------------GSKGIAKF--NAGAGIVRDL- 233
                  ..:.:|:...:...|...||:||               |::...:|  |..|...||. 
Zfish   164 YNATTRQVETELLPCLRYFGIRFFAYNPLAGGLLTGKYHYEDKDGAQPAGRFFGNNWANAYRDRY 228

  Fly   234 ---PDLMDIPEV-KEIAASHG-KTPA--QVLLRWII-------DTGVSAIPKSTNPARLKQNLDV 284
               .....|..| |.:.:::| :.|:  ...:||:.       |.|...|...::..:|.:||..
Zfish   229 WKESHFQGIDGVQKALESAYGSEKPSLTSAAIRWMYHHSHLKGDQGDGVIIGMSSMEQLNENLTA 293

  Fly   285 FDFELTAEEVAKLSSLDQNIRICDFAFFHGVE 316
                 .||...|...:|        ||.|..|
Zfish   294 -----AAEGPLKQEVVD--------AFKHAWE 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2767NP_649757.1 ARA1 5..302 CDD:223729 74/341 (22%)
Tas 10..297 CDD:223739 73/336 (22%)
akr7a3NP_001002369.1 Tas 2..319 CDD:223739 79/357 (22%)
Aldo_ket_red 2..310 CDD:119408 77/353 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.