DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2767 and akr1b1.1

Sequence 1:NP_649757.1 Gene:CG2767 FlyBaseID:FBgn0037537 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_001002048.1 Gene:akr1b1.1 ZFINID:ZDB-GENE-040625-7 Length:315 Species:Danio rerio

Alignment Length:326 Identity:147/327 (45%)
Similarity:206/327 (63%) Gaps:19/327 (6%)


  Fly     7 LTFNNGEKMPVIGIGTWQASDEEIETAIDAALEAGYRHIDTAPVYGNEKAIGRVLKRWLDAGKVK 71
            :|.|||.|||::|:|||::...|:..|:.:|:.:||||||.|.||.||..:|..:...::.|.||
Zfish     4 VTLNNGAKMPIVGLGTWRSPPGEVTEAVKSAILSGYRHIDGAHVYENENEVGDGICAMINQGVVK 68

  Fly    72 REELFIVTKVPPVSNRPHEVEPTIKKSLEDLQLDYVDLYLVHTPFTININEDGSFKLDKEGLMEV 136
            ||:||||:|:....:..|.|....:|:|.||:||||||||:|.|......:| .|.|||:|.:..
Zfish    69 REDLFIVSKLWCTFHEKHLVRGACEKTLSDLKLDYVDLYLMHFPMGTKPGKD-LFPLDKDGHVIP 132

  Fly   137 DVTTNHAAIWVAMEALVEKGLTKSIGVSNFSKDQVARLLK--NCKIRPANNQIEHHVYLQQRDLV 199
            | .:|....|.|||.||:.||.|:||:|||::||:..:|.  ..|.:|||||||.|.||.|..|:
Zfish   133 D-NSNFLETWEAMEELVDAGLVKAIGISNFNRDQIEAILNKPGLKYKPANNQIECHPYLTQEKLI 196

  Fly   200 DFCKSENITVTAYSPLGSKGIAKFNAGAGIVRDLPDLMDIPEVKEIAASHGKTPAQVLLRWIIDT 264
            ::|:|:.|||||||||||.......|      |.|.|::.|::|.||..||||.||||:.:.|..
Zfish   197 NYCQSKGITVTAYSPLGSPNRPWAQA------DEPSLLEDPKIKAIADKHGKTTAQVLIHFHIQR 255

  Fly   265 GVSAIPKSTNPARLKQNLDVFDFELTAEEVAKLSSLDQNIRICDFAFFHGVE---RHPEFTFKNQ 326
            .|..||||..|:|:|:|.:||||||:.||:..:.|.::|.|    ||  |:|   :|.:|....:
Zfish   256 NVVVIPKSVTPSRIKENFEVFDFELSKEEMNTILSFNRNFR----AF--GLEWASKHKDFPLNAE 314

  Fly   327 Y 327
            |
Zfish   315 Y 315

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2767NP_649757.1 ARA1 5..302 CDD:223729 138/297 (46%)
Tas 10..297 CDD:223739 136/289 (47%)
akr1b1.1NP_001002048.1 ARA1 1..296 CDD:223729 139/300 (46%)
Tas 1..288 CDD:223739 137/292 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1016440at2759
OrthoFinder 1 1.000 FOG0000053
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11732
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1770
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
55.040

Return to query results.
Submit another query.