DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2767 and Akr1c13

Sequence 1:NP_649757.1 Gene:CG2767 FlyBaseID:FBgn0037537 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_001014262.3 Gene:Akr1c13 RGDID:1359406 Length:323 Species:Rattus norvegicus

Alignment Length:323 Identity:118/324 (36%)
Similarity:193/324 (60%) Gaps:15/324 (5%)


  Fly    10 NNGEKMPVIGIGTWQASDEEIETAIDA---ALEAGYRHIDTAPVYGNEKAIGRVLKRWLDAGKVK 71
            |:|..:|.:|.||::..:.....:::|   |::.||||||||..|..|:.||:.::..:.||.||
  Rat    11 NDGHFIPALGFGTYKPKEVPKSKSLEAAHLAIDVGYRHIDTASAYQVEEEIGQAIQSKIKAGVVK 75

  Fly    72 REELFIVTKVPPVSNRPHEVEPTIKKSLEDLQLDYVDLYLVHTPFTININEDGSFKLDKEGLMEV 136
            |:::||.||:.....|...|.|.::|||::||||||||:|:|.|..|..:.|.| .||::|...:
  Rat    76 RKDMFITTKLWCSCFRTEMVRPALEKSLKNLQLDYVDLFLIHYPVPIKSSVDES-PLDEKGKFLL 139

  Fly   137 DVTTNHAAIWVAMEALVEKGLTKSIGVSNFSKDQVARLLK--NCKIRPANNQIEHHVYLQQRDLV 199
            | |.:....|..:|...:.||.||||||||:..|:.|||.  ..|.:|..||:|.|:||.|..|:
  Rat   140 D-TVDFCDTWEMLEKCKDAGLVKSIGVSNFNHKQLERLLNKPGLKYKPVCNQVECHLYLNQSKLL 203

  Fly   200 DFCKSENITVTAYSPLGSKGIAKFNAGAGIVRDLPDLMDIPEVKEIAASHGKTPAQVLLRWIIDT 264
            |:|||::|.:.||..||::...::     :.::.|.|:|.|.:.::|..:.::||.:.||::...
  Rat   204 DYCKSKDIVLVAYGALGTQRYKEW-----VDQNSPVLLDDPILCDVAKKNKRSPALIALRYLFQR 263

  Fly   265 GVSAIPKSTNPARLKQNLDVFDFELTAEEVAKLSSLDQNIRICDFAFFHGVERHPEFTFKNQY 327
            ||..:.:|.....:::||.||:|:|:.|::..|..|::|.|.....|   :..|||:.|..:|
  Rat   264 GVVPLAQSFKENEMRENLQVFEFQLSPEDMKTLDGLNKNFRYLSAEF---LADHPEYPFSEEY 323

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2767NP_649757.1 ARA1 5..302 CDD:223729 110/297 (37%)
Tas 10..297 CDD:223739 108/292 (37%)
Akr1c13NP_001014262.3 ARA1 8..305 CDD:223729 112/301 (37%)
Tas 16..297 CDD:223739 107/288 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H105824
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1016440at2759
OrthoFinder 1 1.000 FOG0000053
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11732
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.010

Return to query results.
Submit another query.