DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2767 and Akr1c15

Sequence 1:NP_649757.1 Gene:CG2767 FlyBaseID:FBgn0037537 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_001103370.1 Gene:Akr1c15 RGDID:1307514 Length:324 Species:Rattus norvegicus

Alignment Length:337 Identity:126/338 (37%)
Similarity:187/338 (55%) Gaps:29/338 (9%)


  Fly     3 NTKFLTFNNGEKMPVIGIGTWQASDEEIETAIDA---ALEAGYRHIDTAPVYGNEKAIGRVLKRW 64
            :::.:..|:|..|||:|.||:.:.:.....|.:|   |::.|:||||.|..|.||:.:|:.|:..
  Rat     5 HSRSVKLNDGNLMPVLGFGTFASKEIPKSKAAEATKVAIDVGFRHIDAAYFYQNEEEVGQALRDK 69

  Fly    65 LDAGKVKREELFIVTKVPPVSNRPHEVEPTIKKSLEDLQLDYVDLYLVHTPFTININED------ 123
            :..|.||||:||..||:.....||..|...:::||:.|.||||||.::|.|..:...|:      
  Rat    70 MADGTVKREDLFYTTKIWITFLRPELVRQCLERSLKKLGLDYVDLCIIHIPIAMKPGEELLPKDA 134

  Fly   124 -GSFKLDKEGLMEVDVTTNHAAIWVAMEALVEKGLTKSIGVSNFSKDQVARLLK--NCKIRPANN 185
             |.|..|     .||:...    |.|:|...:.||:||||||||:..|:..:|.  ..|.:|..|
  Rat   135 NGKFIFD-----TVDIRDT----WEALEKCKDAGLSKSIGVSNFNHKQLELILNKPRLKYKPTCN 190

  Fly   186 QIEHHVYLQQRDLVDFCKSENITVTAYSPLGSKGIAKFNAGAGIVRDLPDLMDIPEVKEIAASHG 250
            |:|.|.||.|..|::||||::|.:.|||.|||     ....:.:..|.|.|::.|.:..||..|.
  Rat   191 QVECHPYLNQSKLLEFCKSKDIVLVAYSALGS-----HRDSSWVSSDSPYLLEDPVLMTIAKKHN 250

  Fly   251 KTPAQVLLRWIIDTGVSAIPKSTNPARLKQNLDVFDFELTAEEVAKLSSLDQNIRICDFAFFHGV 315
            :||.||.||:.:..||..:.||.|..|:|:|..|||||||.|::..:.||::|.|....||   .
  Rat   251 QTPGQVALRYQLQRGVVVLAKSFNEKRIKENFQVFDFELTPEDMKTIDSLNRNFRYSQMAF---A 312

  Fly   316 ERHPEFTFKNQY 327
            ..||::.|..:|
  Rat   313 LDHPDYPFLEEY 324

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2767NP_649757.1 ARA1 5..302 CDD:223729 118/309 (38%)
Tas 10..297 CDD:223739 116/299 (39%)
Akr1c15NP_001103370.1 ARA1 9..306 CDD:223729 120/311 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1016440at2759
OrthoFinder 1 1.000 FOG0000053
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11732
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.