DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2767 and Akr1c12

Sequence 1:NP_649757.1 Gene:CG2767 FlyBaseID:FBgn0037537 Length:329 Species:Drosophila melanogaster
Sequence 2:XP_006254252.1 Gene:Akr1c12 RGDID:1308232 Length:371 Species:Rattus norvegicus

Alignment Length:297 Identity:113/298 (38%)
Similarity:181/298 (61%) Gaps:12/298 (4%)


  Fly    33 AIDAALEAGYRHIDTAPVYGNEKAIGRVLKRWLDAGKVKREELFIVTKVPPVSNRPHEVEPTIKK 97
            |...|::|||||||||..|..|:.||:.::..:.||.||||::||.||:.....||..|:|.::|
  Rat    85 AAHLAIDAGYRHIDTAYAYQIEEEIGQAIQSKIKAGVVKREDMFITTKLWCTCFRPELVKPALEK 149

  Fly    98 SLEDLQLDYVDLYLVHTPFTININEDGSFKLDKEGLMEVDVTTNHAAIWVAMEALVEKGLTKSIG 162
            ||::|||||.|||::|.|..:. :.|..|.:|::|...:| |.:....|..:|...:.||.||||
  Rat   150 SLKNLQLDYADLYIMHYPVPMK-SGDNDFPVDEKGKSLLD-TVDFCDTWEMLEKCKDAGLVKSIG 212

  Fly   163 VSNFSKDQVARLLK--NCKIRPANNQIEHHVYLQQRDLVDFCKSENITVTAYSPLGSKGIAKFNA 225
            ||||:..|:.|||.  ..|.:|..||:|.|:||.|..|:|:|||::|.:.||..||::...::  
  Rat   213 VSNFNHKQLERLLNKPGLKYKPVCNQVECHLYLNQSKLLDYCKSKDIVLVAYGALGTQRYKEW-- 275

  Fly   226 GAGIVRDLPDLMDIPEVKEIAASHGKTPAQVLLRWIIDTGVSAIPKSTNPARLKQNLDVFDFELT 290
               :.::.|.|::.|.:.::|..:.::||.:.||:::..||..:.:|.....:::||.||||:|:
  Rat   276 ---VDQNSPVLLNDPVLCDVAKKNKRSPALIALRYLVQRGVVPLAQSFKENEMRENLQVFDFQLS 337

  Fly   291 AEEVAKLSSLDQNIRICDFAFFHGVERHPEFTFKNQY 327
            .|::..|..|::|.|.....|..|   |||:.|..:|
  Rat   338 PEDMKTLDGLNKNFRYLSAEFLAG---HPEYPFSEEY 371

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2767NP_649757.1 ARA1 5..302 CDD:223729 104/271 (38%)
Tas 10..297 CDD:223739 102/266 (38%)
Akr1c12XP_006254252.1 Tas 77..345 CDD:223739 103/267 (39%)
ARA1 89..353 CDD:223729 105/271 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1016440at2759
OrthoFinder 1 1.000 FOG0000053
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11732
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.