DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2767 and zgc:56622

Sequence 1:NP_649757.1 Gene:CG2767 FlyBaseID:FBgn0037537 Length:329 Species:Drosophila melanogaster
Sequence 2:XP_005169977.1 Gene:zgc:56622 ZFINID:ZDB-GENE-030131-4758 Length:324 Species:Danio rerio

Alignment Length:323 Identity:131/324 (40%)
Similarity:194/324 (60%) Gaps:14/324 (4%)


  Fly     7 LTFNNGEKMPVIGIGTWQ---ASDEEIETAIDAALEAGYRHIDTAPVYGNEKAIGRVLKRWLDAG 68
            :..|:|..||::|:|||:   ...:..:.|.:||:.|||||||||..|.||..:|..::..:..|
Zfish    11 IELNDGTFMPLLGLGTWKPESTGPDMCQRACEAAIAAGYRHIDTAFCYRNEVDVGMAIQNKIQQG 75

  Fly    69 KVKREELFIVTKVPPVSNRPHEVEPTIKKSLEDLQLDYVDLYLVHTPFTININEDGSFKLDKEG- 132
            .::|:::|||:|:....:.|.::.....|||.||||||:|.||||.|..:....|..|. :::| 
Zfish    76 IIRRQDMFIVSKLWGTHHAPEDIPVCFNKSLSDLQLDYLDQYLVHFPVGLKKVGDELFP-ERDGK 139

  Fly   133 LMEVDVTTNHAAIWVAMEALVEKGLTKSIGVSNFSKDQVARLLKNCKIRPANNQIEHHVYLQQRD 197
            ::..|:  ::..:|..||||...|..||||||||:.:|:.|||...||.||.||:|.|.||.|.|
Zfish   140 ILTTDI--DYVDVWRGMEALKATGKVKSIGVSNFTMEQIDRLLSVAKIPPAVNQVELHPYLVQSD 202

  Fly   198 LVDFCKSENITVTAYSPLGSKG-IAKFNAGAGIVRDLPDLMDIPEVKEIAASHGKTPAQVLLRWI 261
            |:|:|||:||.:||:||.||.| ..:|..|.   :|...|::.|.|.::|..|.:||||||||:.
Zfish   203 LIDYCKSKNIALTAHSPFGSPGRPLEFQTGD---KDPMGLLEDPVVVDVARKHRRTPAQVLLRYH 264

  Fly   262 IDTGVSAIPKSTNPARLKQNLDVFDFELTAEEVAKLSSLDQNIRICDFAFFHGVERHPEFTFK 324
            |...::.||||..|..:.:|..:|||.|..|::..|.||::..|.|   ....:|.|..:.||
Zfish   265 IQQDIAVIPKSVKPHHILENTKIFDFTLDEEDMNALKSLNRGWRAC---IITELEAHYFYPFK 324

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2767NP_649757.1 ARA1 5..302 CDD:223729 125/300 (42%)
Tas 10..297 CDD:223739 122/292 (42%)
zgc:56622XP_005169977.1 ARA1 10..308 CDD:223729 125/303 (41%)
Tas 22..300 CDD:223739 118/284 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1016440at2759
OrthoFinder 1 1.000 FOG0000053
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11732
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.