DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2767 and Akr1c1

Sequence 1:NP_649757.1 Gene:CG2767 FlyBaseID:FBgn0037537 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_001028869.1 Gene:Akr1c1 RGDID:1306847 Length:323 Species:Rattus norvegicus

Alignment Length:335 Identity:132/336 (39%)
Similarity:200/336 (60%) Gaps:21/336 (6%)


  Fly     2 VNTKFLT--FNNGEKMPVIGIGTWQASDEEIETAIDA---ALEAGYRHIDTAPVYGNEKAIGRVL 61
            :|:|..|  .::|..:||:|.||:...:.....|::|   |::||:||||:|.||.|||.:|..:
  Rat     1 MNSKQQTVRLSDGHFIPVLGFGTYAPREVPKSKALEATKIAIDAGFRHIDSAAVYQNEKEVGLAI 65

  Fly    62 KRWLDAGKVKREELFIVTKVPPVSNRPHEVEPTIKKSLEDLQLDYVDLYLVHTPFTININEDGSF 126
            :..:..|.||||::|..:||....|.|..|:..:::||:.|||:||||||:|.|..:...||...
  Rat    66 RSKIADGTVKREDIFYTSKVWCTFNHPERVQVCLEQSLKQLQLEYVDLYLIHFPMALKPEEDLKA 130

  Fly   127 KLDKEGLM--EVDVTTNHAAIWVAMEALVEKGLTKSIGVSNFSKDQVARLLK--NCKIRPANNQI 187
            |.:.|.|:  .||:...    |.|||...:.||.||||||||::.|:.::|.  ..|.||..||:
  Rat   131 KDENEKLLFDVVDICDT----WKAMEKCKDAGLAKSIGVSNFNRRQLEKILNKPGLKHRPVCNQV 191

  Fly   188 EHHVYLQQRDLVDFCKSENITVTAYSPLGSKGIAKFNAGAGIVRDLPDLMDIPEVKEIAASHGKT 252
            |.|.||.||.|:|||||::|.:.|||.|||....:.     :.:.||.|:..|.:..||..:..|
  Rat   192 ECHPYLNQRKLLDFCKSKDIVLVAYSALGSHRETRC-----VDKSLPVLLADPVLCAIAKKYNWT 251

  Fly   253 PAQVLLRWIIDTGVSAIPKSTNPARLKQNLDVFDFELTAEEVAKLSSLDQNIRICDFAFFHGVER 317
            ||.:.||:.::.||..:.||....|:|:|:.||:|:||:|::..|..|::|||....:.|.|   
  Rat   252 PALIALRYQLERGVVVLAKSFTEKRIKENMQVFEFQLTSEDMKVLDGLNKNIRYMSGSRFQG--- 313

  Fly   318 HPEFTFKNQY 327
            ||:|.|.::|
  Rat   314 HPDFPFLDEY 323

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2767NP_649757.1 ARA1 5..302 CDD:223729 121/306 (40%)
Tas 10..297 CDD:223739 117/294 (40%)
Akr1c1NP_001028869.1 ARA1 5..305 CDD:223729 123/309 (40%)
Tas 16..297 CDD:223739 117/290 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1016440at2759
OrthoFinder 1 1.000 FOG0000053
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11732
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.