DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2767 and Akr1b10

Sequence 1:NP_649757.1 Gene:CG2767 FlyBaseID:FBgn0037537 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_001013102.1 Gene:Akr1b10 RGDID:1308277 Length:316 Species:Rattus norvegicus

Alignment Length:330 Identity:135/331 (41%)
Similarity:205/331 (62%) Gaps:25/331 (8%)


  Fly     6 FLTFNNGEKMPVIGIGTWQASDEEIETAIDAALEAGYRHIDTAPVYGNEKAIGRVLKRWLDAGKV 70
            |:..:...|||::|:|||::..::::.|:.||::|||||.|.|.||.||..:|..::..:....|
  Rat     4 FVKLSTKAKMPIVGLGTWKSPPDKVKEAVKAAIDAGYRHFDCAYVYQNESEVGEAIQEKIKEKAV 68

  Fly    71 KREELFIVTKVPPVSNRPHEVEPTIKKSLEDLQLDYVDLYLVHTPFTININEDGSFKL---DKEG 132
            :||:||||:|:.|.......|:...:|:|.||:|||:||||:|.|...   :.|:..|   ||..
  Rat    69 RREDLFIVSKLWPTFFEKSLVKKAFQKTLLDLKLDYLDLYLIHWPQGF---QSGNVFLPTDDKGN 130

  Fly   133 LMEVDVTTNHAAIWVAMEALVEKGLTKSIGVSNFSKDQVARLLK--NCKIRPANNQIEHHVYLQQ 195
            ::....|...|  |..||.||::||.|::|||||:..|:.|||.  ..|.:|..||:|.|.||.|
  Rat   131 VLTSKYTFLDA--WEGMEELVDQGLVKALGVSNFNHFQIERLLNKPGLKHKPVTNQVECHPYLTQ 193

  Fly   196 RDLVDFCKSENITVTAYSPLGS--KGIAKFNAGAGIVRDLPDLMDIPEVKEIAASHGKTPAQVLL 258
            ..|:.:|.|:.|.|||||||||  :..||        .:.|.|::||::||||:.|.||.||||:
  Rat   194 EKLIQYCHSKGIVVTAYSPLGSPDRPSAK--------PEDPVLLEIPKIKEIASKHKKTAAQVLI 250

  Fly   259 RWIIDTGVSAIPKSTNPARLKQNLDVFDFELTAEEVAKLSSLDQNIRICD-FAFFHGVERHPEFT 322
            |:.|:..|:.||||..|:|:::|:.||||:|:.|::|.:.|.::|.|.|. ||    ..|:.:|.
  Rat   251 RFHIERNVAVIPKSVTPSRIQENIQVFDFQLSEEDMAAILSFNRNWRACGLFA----ASRNEDFP 311

  Fly   323 FKNQY 327
            |.::|
  Rat   312 FHSEY 316

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2767NP_649757.1 ARA1 5..302 CDD:223729 126/303 (42%)
Tas 10..297 CDD:223739 124/294 (42%)
Akr1b10NP_001013102.1 ARA1 1..297 CDD:223729 127/306 (42%)
Tas 16..289 CDD:223739 121/286 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1016440at2759
OrthoFinder 1 1.000 FOG0000053
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.