DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2767 and Akr1c2

Sequence 1:NP_649757.1 Gene:CG2767 FlyBaseID:FBgn0037537 Length:329 Species:Drosophila melanogaster
Sequence 2:XP_006254245.1 Gene:Akr1c2 RGDID:1311841 Length:323 Species:Rattus norvegicus

Alignment Length:333 Identity:115/334 (34%)
Similarity:190/334 (57%) Gaps:17/334 (5%)


  Fly     2 VNTK--FLTFNNGEKMPVIGIGTWQASD---EEIETAIDAALEAGYRHIDTAPVYGNEKAIGRVL 61
            :|:|  .:..|:|..:||:|.||...|:   .:.:.....|::||:.|.|:|.||..|..:|..:
  Rat     1 MNSKCHCVKLNDGHFIPVLGFGTAMPSELPKSKAKEVTKIAIDAGFHHFDSAFVYNTEDHVGEAI 65

  Fly    62 KRWLDAGKVKREELFIVTKVPPVSNRPHEVEPTIKKSLEDLQLDYVDLYLVHTPFTININEDGSF 126
            :..:..|..:||::|..:|:...|..|..|..:::.||:.||||||||||:|.|..:... |.:|
  Rat    66 REKIANGTTRREDIFYTSKLWCTSLHPELVRSSLECSLKKLQLDYVDLYLIHFPMALKPG-DENF 129

  Fly   127 KLDKEGLMEVDVTTNHAAIWVAMEALVEKGLTKSIGVSNFSKDQVARLLK--NCKIRPANNQIEH 189
            .:|:.|.:..| |.:..|.|.|||...:.||.||||||||::.|:.::|.  ..|.:|..||:|.
  Rat   130 PVDEHGKLLFD-TVDLCATWEAMEKCKDAGLAKSIGVSNFNRRQLEKILNKPGLKYKPVCNQVEC 193

  Fly   190 HVYLQQRDLVDFCKSENITVTAYSPLGSKGIAKFNAGAGIVRDLPDLMDIPEVKEIAASHGKTPA 254
            |:||.|..|:||||:..|.:.||..||::   ::|  ..:.::.|.|::.|.:..:|..:.:|||
  Rat   194 HLYLNQMKLLDFCKTNGIILVAYGVLGTQ---RYN--GWVDQNSPVLLNEPVLSSMAKKYNQTPA 253

  Fly   255 QVLLRWIIDTGVSAIPKSTNPARLKQNLDVFDFELTAEEVAKLSSLDQNIRICDFAFFHGVERHP 319
            .:.||..:..|:..:..|....|:|:|:.||:|:|:.|::..|..|::|:|......|.|   ||
  Rat   254 LIALRHQLQRGIVVLNTSLKEERIKENMKVFEFQLSPEDMKVLDDLNRNLRYIAGGIFEG---HP 315

  Fly   320 EFTFKNQY 327
            .|.|.::|
  Rat   316 NFPFLDEY 323

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2767NP_649757.1 ARA1 5..302 CDD:223729 105/304 (35%)
Tas 10..297 CDD:223739 102/292 (35%)
Akr1c2XP_006254245.1 ARA1 8..317 CDD:223729 110/319 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1016440at2759
OrthoFinder 1 1.000 FOG0000053
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11732
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.