DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2767 and SPAP32A8.02

DIOPT Version :9

Sequence 1:NP_649757.1 Gene:CG2767 / 40946 FlyBaseID:FBgn0037537 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_594178.1 Gene:SPAP32A8.02 / 2541584 PomBaseID:SPAP32A8.02 Length:283 Species:Schizosaccharomyces pombe


Alignment Length:311 Identity:104/311 - (33%)
Similarity:153/311 - (49%) Gaps:47/311 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LTFNNGEKMPVIGIGTWQASDEEIETAIDAALEAGYRHIDTAPVYGNEKAIGRVLKRWLDAGKVK 71
            :|..||..:|.||.|.:.....|....:..||::||||||||.|||||...|:.:..|.:...||
pombe    11 VTLTNGMVIPRIGFGAFMLKYNECYGLVTQALDSGYRHIDTAAVYGNEDICGKAIVDWCEKNNVK 75

  Fly    72 REELFIVTKVPPVSNRPHEVEPTIKKSLEDLQLDYVDLYLVHTPFTININEDGSFKLDKEGLMEV 136
            |.::|:.:|:...|:. :.....|:.||..|. .|:||:|:.:|       .|..|         
pombe    76 RTDIFLTSKLANCSDY-YSTRAAIRSSLHHLG-TYIDLFLIQSP-------AGGKK--------- 122

  Fly   137 DVTTNHAAIWVAMEALVEKGLTKSIGVSNFSKDQVARL-LKNCKIRPANNQIEHHVYLQQRDLVD 200
                :..|.|.|||..|:.|..:|:||||:....:..| ..|.|..|..||||.|.:|.|.|:|.
pombe   123 ----SRIASWKAMEEFVDSGDIRSVGVSNYGVKHLQELYASNPKFYPCVNQIELHPFLSQDDIVK 183

  Fly   201 FCKSENITVTAYSPLGSKGIAKFNAGAGIVRDLPDLMDIPEVKEIAASHGKTPAQVLLRWIIDTG 265
            :|:|.:|.:.||||| :.||.           |.|...:|..|::..|    .||:|:||.:..|
pombe   184 YCQSHDIAIEAYSPL-THGIR-----------LNDEKLVPIAKKLNIS----VAQLLIRWSLQKG 232

  Fly   266 VSAIPKSTNPARLKQNLDVFDFELTAEEVAKLSSLDQNIR--------ICD 308
            ...|.|||....:..:||||:|.:..:.|.:|||.|::..        :||
pombe   233 YIPIIKSTKKEHMLSDLDVFNFTIPDDVVQELSSFDEHWHAGTTYDPTVCD 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2767NP_649757.1 ARA1 5..302 CDD:223729 101/295 (34%)
Tas 10..297 CDD:223739 97/287 (34%)
SPAP32A8.02NP_594178.1 ARA1 6..283 CDD:223729 102/309 (33%)
Tas 16..279 CDD:223739 100/300 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.