DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2767 and AKR1B1

Sequence 1:NP_649757.1 Gene:CG2767 FlyBaseID:FBgn0037537 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_001619.1 Gene:AKR1B1 HGNCID:381 Length:316 Species:Homo sapiens

Alignment Length:328 Identity:138/329 (42%)
Similarity:195/329 (59%) Gaps:29/329 (9%)


  Fly     7 LTFNNGEKMPVIGIGTWQASDEEIETAIDAALEAGYRHIDTAPVYGNEKAIGRVLKRWLDAGKVK 71
            |..|||.|||::|:|||::...::..|:..|::.||||||.|.||.||..:|..::..|....||
Human     5 LLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVK 69

  Fly    72 REELFIVTKVPPVSNRPHEVEPTIKKSLEDLQLDYVDLYLVHTPFTININEDGSFKLDKEGLMEV 136
            |||||||:|:....:....|:...:|:|.||:|||:||||:|.|......:: .|.||:.|.: |
Human    70 REELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKE-FFPLDESGNV-V 132

  Fly   137 DVTTNHAAIWVAMEALVEKGLTKSIGVSNFSKDQVARLLK--NCKIRPANNQIEHHVYLQQRDLV 199
            ...||....|.|||.||::||.|:||:|||:..||..:|.  ..|.:||.||||.|.||.|..|:
Human   133 PSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLI 197

  Fly   200 DFCKSENITVTAYSPLGS--KGIAKFNAGAGIVRDLPDLMDIPEVKEIAASHGKTPAQVLLRWII 262
            .:|:|:.|.|||||||||  :..||        .:.|.|::.|.:|.|||.|.||.||||:|:.:
Human   198 QYCQSKGIVVTAYSPLGSPDRPWAK--------PEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPM 254

  Fly   263 DTGVSAIPKSTNPARLKQNLDVFDFELTAEEVAKLSSLDQNIRIC---------DFAFFHGVERH 318
            ...:..||||..|.|:.:|..||||||:::::..|.|.::|.|:|         |:.|      |
Human   255 QRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPF------H 313

  Fly   319 PEF 321
            .||
Human   314 EEF 316

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2767NP_649757.1 ARA1 5..302 CDD:223729 130/299 (43%)
Tas 10..297 CDD:223739 127/291 (44%)
AKR1B1NP_001619.1 ARA1 1..297 CDD:223729 131/302 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1016440at2759
OrthoFinder 1 1.000 FOG0000053
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11732
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1770
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
55.040

Return to query results.
Submit another query.