DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2767 and ZK1290.5

Sequence 1:NP_649757.1 Gene:CG2767 FlyBaseID:FBgn0037537 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_495578.2 Gene:ZK1290.5 WormBaseID:WBGene00022887 Length:321 Species:Caenorhabditis elegans

Alignment Length:315 Identity:112/316 (35%)
Similarity:164/316 (52%) Gaps:46/316 (15%)


  Fly     1 MVNTKFLTFNNGEKMPVIGIGTWQASDEEIETAIDAALEAGYRHIDTAPVYGNEKAIGRVLKRWL 65
            |:.|..|  :|..:||:||:||..:.....:..:.:..:.|||.||||..||.||.:|..:|.. 
 Worm     1 MIPTTVL--SNNVEMPLIGLGTTHSGGYYHDAVLHSIKKCGYRLIDTAKRYGVEKQLGIAVKNC- 62

  Fly    66 DAGKVKREELFIVTKVPPVSNRPHEVEPTIKKSLEDLQLDYVDLYLVHTP----FTININEDGSF 126
               .|.|||:|:.||:.|| :...||....:.|.|.||.||:|:|::|.|    :.:|..|    
 Worm    63 ---SVPREEMFLSTKLWPV-DCGDEVYNAFQTSCEKLQTDYLDMYMIHMPQLPDWIVNQKE---- 119

  Fly   127 KLDKEGLMEVDVTTNHAAIWVAMEALVEKGLTKSIGVSNFSKDQVARLLKNCKIRPANNQIEHHV 191
              .||            ..|..||.|.|....:||||||:|.:.:..||:...|.|..||:|.|.
 Worm   120 --TKE------------KTWRQMELLYEDEHVRSIGVSNYSIEDLDELLEFASILPHANQVELHP 170

  Fly   192 YLQQRDLVDFCKSENITVTAYSPLGSKGIAKFNAGAGIVRDLPDLMDIPEVKEIAASHGKTPAQV 256
            :..|.||.::|....|....|.|| :||  |:             ::...:.:||:.:.|:|||:
 Worm   171 WFHQADLKNYCDELGILTMGYCPL-AKG--KY-------------LEDETLCKIASKYQKSPAQI 219

  Fly   257 LLRWIIDTGVSAIPKSTNPARLKQNLDVFDFELTAEEVAKLSSL-DQNIRICDFA 310
            .|||.|...|..:||||:..|||:|.:||||||:||::..|:|. .||.:|.|.:
 Worm   220 CLRWSIQQNVPTVPKSTDCRRLKENTNVFDFELSAEDMNTLNSFSSQNRKIVDLS 274

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2767NP_649757.1 ARA1 5..302 CDD:223729 106/302 (35%)
Tas 10..297 CDD:223739 103/291 (35%)
ZK1290.5NP_495578.2 ARA1 1..268 CDD:223729 110/308 (36%)
Tas 16..261 CDD:223739 101/284 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.