DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2767 and F53F1.3

Sequence 1:NP_649757.1 Gene:CG2767 FlyBaseID:FBgn0037537 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_506323.1 Gene:F53F1.3 WormBaseID:WBGene00009981 Length:283 Species:Caenorhabditis elegans

Alignment Length:301 Identity:100/302 (33%)
Similarity:148/302 (49%) Gaps:40/302 (13%)


  Fly     7 LTFNNGEKMPVIGIGTWQASDEEIETAIDAALEAGYRHIDTAPVYGNEKAIGRVLKRWLDAGKVK 71
            :..|.|...|:||:||::...:::...:||||.||||..|||.||.|||.||..|:..|....:|
 Worm     3 IKLNTGYDCPLIGLGTYKIIGDQVLPVLDAALTAGYRLFDTAKVYNNEKEIGDALEILLPKHNLK 67

  Fly    72 REELFIVTKVPPVSNRPHEVEPTIKKSLEDLQLDYVDLYLVHTPFTININEDGSFKLDKEGLMEV 136
            ||::||.||:.|  |....|:..:.:||..|:..|:|:||:|.|.:.:..:.....         
 Worm    68 REDIFITTKMHP--NTVENVKKLVDESLSLLKTSYIDMYLIHYPKSFDYGDQDPMN--------- 121

  Fly   137 DVTTNHAAIWVAMEALVEKGLTKSIGVSNFS---KDQVARLLKNCKIRPANNQIEHHVYLQQRDL 198
              .|...|.|..:......|..:|:|||:|.   .:::..|.||  ..|..||:|:|.:..:.:|
 Worm   122 --KTLRIATWNDLWECKNAGKIRSVGVSSFEIRHLEELKDLGKN--FPPCCNQVEYHPHFTREEL 182

  Fly   199 VDFCKSENITVTAYSPLGSKGIAKFN---AGAGIVRDLPDLMDIPEVKEIAASHGKTPAQVLLRW 260
            .::||||.|...|:|.|     |:.|   ..:.|:..|.:...:|:            ..|||.|
 Worm   183 KNYCKSEGIFFQAFSSL-----ARHNETLLSSEIITRLAEKYHVPK------------TTVLLSW 230

  Fly   261 IIDTGVSAIPKSTNPARLKQNLDVFDFELTAEEVAKLSSLD 301
            .....|..|||||||.||.|||.....|  .|||.|:.:|:
 Worm   231 ATSQKVGIIPKSTNPERLAQNLKTVLLE--EEEVKKICNLN 269

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2767NP_649757.1 ARA1 5..302 CDD:223729 100/302 (33%)
Tas 10..297 CDD:223739 99/293 (34%)
F53F1.3NP_506323.1 ARA1 1..279 CDD:223729 100/302 (33%)
Tas 6..265 CDD:223739 99/293 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.