DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2767 and C56G3.2

Sequence 1:NP_649757.1 Gene:CG2767 FlyBaseID:FBgn0037537 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_509247.2 Gene:C56G3.2 WormBaseID:WBGene00016985 Length:131 Species:Caenorhabditis elegans

Alignment Length:84 Identity:29/85 (34%)
Similarity:48/85 (56%) Gaps:12/85 (14%)


  Fly    88 PHEVEPTIKKSLEDLQLDYVDLYLVHTPFTININEDGSFKLDKEGLMEVDVTTNHAAIWVAMEAL 152
            |..:|..::.||:.|.|:||||||.|.|..  .::|.|.|::          ::...||...:|:
 Worm    59 PGRLEGALRDSLKKLHLEYVDLYLAHMPTA--FSDDMSQKIE----------SSVEDIWRQFDAV 111

  Fly   153 VEKGLTKSIGVSNFSKDQV 171
            .:.||.|::||||::.||:
 Worm   112 YKAGLAKAVGVSNWNNDQI 130

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2767NP_649757.1 ARA1 5..302 CDD:223729 29/85 (34%)
Tas 10..297 CDD:223739 29/85 (34%)
C56G3.2NP_509247.2 Tas <53..>131 CDD:223739 29/85 (34%)
Aldo_ket_red <59..>131 CDD:294321 29/85 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11732
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.