DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2767 and C07D8.5

Sequence 1:NP_649757.1 Gene:CG2767 FlyBaseID:FBgn0037537 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_509243.1 Gene:C07D8.5 WormBaseID:WBGene00015564 Length:134 Species:Caenorhabditis elegans

Alignment Length:76 Identity:38/77 (49%)
Similarity:53/77 (69%) Gaps:0/77 (0%)


  Fly     7 LTFNNGEKMPVIGIGTWQASDEEIETAIDAALEAGYRHIDTAPVYGNEKAIGRVLKRWLDAGKVK 71
            ||.:|...||.:|:||||::.|::.:|:.||::.||..||||..|.||:.||..:|..:..|.||
 Worm    48 LTLSNAHSMPAVGLGTWQSNAEDVISAVKAAVKNGYSLIDTASGYNNEEFIGTAIKEVIAEGVVK 112

  Fly    72 REELFIVTKVP 82
            ||:|||.||||
 Worm   113 REDLFITTKVP 123

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2767NP_649757.1 ARA1 5..302 CDD:223729 38/77 (49%)
Tas 10..297 CDD:223739 36/74 (49%)
C07D8.5NP_509243.1 ARA1 45..>124 CDD:223729 38/77 (49%)
Tas 57..>122 CDD:223739 32/65 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11732
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.