DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2767 and C07D8.6

Sequence 1:NP_649757.1 Gene:CG2767 FlyBaseID:FBgn0037537 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_509242.1 Gene:C07D8.6 WormBaseID:WBGene00015565 Length:317 Species:Caenorhabditis elegans

Alignment Length:331 Identity:141/332 (42%)
Similarity:190/332 (57%) Gaps:34/332 (10%)


  Fly     4 TKFLTFNNGEKMPVIGIGTWQASDEEIETAIDAALEAGYRHIDTAPVYGNEKAIGRVLKRWLDAG 68
            |..:..:||.:|||||:||||:|..|:.||:..|::||||.||||.||.||:|||..:|..|:.|
 Worm     5 TASIKLSNGVEMPVIGLGTWQSSPAEVITAVKTAVKAGYRLIDTASVYQNEEAIGTAIKELLEEG 69

  Fly    69 KVKREELFIVTKVPPVSNRPHEVEPTIKKSLEDLQLDYVDLYLVHTPFTININEDGSFKLDKEGL 133
            .||||||||.||.......|.::|..:::||:.|||:||||||.|.|...|              
 Worm    70 VVKREELFITTKAWTHELAPGKLEGGLRESLKKLQLEYVDLYLAHMPAAFN-------------- 120

  Fly   134 MEVDVTTNHAA-----IWVAMEALVEKGLTKSIGVSNFSKDQVARLLKNCKIRPANNQIEHHVYL 193
               |..:.|.|     :|...:|:.:.||.|::||||::.||::|.|........|:|:|.|:|.
 Worm   121 ---DDMSEHIASPVEDVWRQFDAVYKAGLAKAVGVSNWNNDQISRALALGLTPVHNSQVELHLYF 182

  Fly   194 QQRDLVDFCKSENITVTAYSPLGSKGIAKFNAGAGIVRDL----PDLMDIPEVKEIAASHGKTPA 254
            .|.|.|||||..||:||:|:.|||.|...|....|...|.    .||.| ..|..:|....||||
 Worm   183 PQHDHVDFCKKHNISVTSYATLGSPGRVNFTLPTGQKLDWAPAPSDLQD-QNVLALAEKTHKTPA 246

  Fly   255 QVLLRWIIDTGVSAIPKSTNPARLKQNLDVFDFELTAEEVAKL--SSLDQNIRICDFAFFHGVER 317
            |||||:.:|.|.:.:|||....|:|:|.:||||.||.|::|||  |...|.:.:.||     :..
 Worm   247 QVLLRYALDRGCAILPKSIQENRIKENFEVFDFSLTEEDIAKLEESKNSQRLFLQDF-----MTG 306

  Fly   318 HPEFTF 323
            |||..|
 Worm   307 HPEDAF 312

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2767NP_649757.1 ARA1 5..302 CDD:223729 133/308 (43%)
Tas 10..297 CDD:223739 131/296 (44%)
C07D8.6NP_509242.1 ARA1 8..291 CDD:223729 132/301 (44%)
Tas 13..291 CDD:223739 131/296 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H105824
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1016440at2759
OrthoFinder 1 1.000 FOG0000053
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR11732
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
65.970

Return to query results.
Submit another query.