| Sequence 1: | NP_649757.1 | Gene: | CG2767 / 40946 | FlyBaseID: | FBgn0037537 | Length: | 329 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_509242.1 | Gene: | C07D8.6 / 180997 | WormBaseID: | WBGene00015565 | Length: | 317 | Species: | Caenorhabditis elegans | 
| Alignment Length: | 331 | Identity: | 141/331 - (42%) | 
|---|---|---|---|
| Similarity: | 190/331 - (57%) | Gaps: | 34/331 - (10%) | 
- Green bases have known domain annotations that are detailed below.
| 
  Fly     4 TKFLTFNNGEKMPVIGIGTWQASDEEIETAIDAALEAGYRHIDTAPVYGNEKAIGRVLKRWLDAG 68 
  Fly    69 KVKREELFIVTKVPPVSNRPHEVEPTIKKSLEDLQLDYVDLYLVHTPFTININEDGSFKLDKEGL 133 
  Fly   134 MEVDVTTNHAA-----IWVAMEALVEKGLTKSIGVSNFSKDQVARLLKNCKIRPANNQIEHHVYL 193 
  Fly   194 QQRDLVDFCKSENITVTAYSPLGSKGIAKFNAGAGIVRDL----PDLMDIPEVKEIAASHGKTPA 254 
  Fly   255 QVLLRWIIDTGVSAIPKSTNPARLKQNLDVFDFELTAEEVAKL--SSLDQNIRICDFAFFHGVER 317 
  Fly   318 HPEFTF 323 | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| CG2767 | NP_649757.1 | ARA1 | 5..302 | CDD:223729 | 133/307 (43%) | 
| Tas | 10..297 | CDD:223739 | 130/295 (44%) | ||
| C07D8.6 | NP_509242.1 | AKR_AKR1G1_CeAKR | 5..301 | CDD:381380 | 135/313 (43%) | 
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 1 | 1.000 | - | - | H105824 | |
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 1 | 1.010 | - | - | QHG53635 | |
| OrthoDB | 1 | 1.010 | - | - | D1016440at2759 | |
| OrthoFinder | 1 | 1.000 | - | - | FOG0000042 | |
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 1 | 0.900 | - | - | OOG6_100072 | |
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 1 | 1.000 | - | - | X51 | |
| SwiftOrtho | 1 | 1.000 | - | - | ||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 8 | 7.830 | |||||