DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2767 and F53F1.2

Sequence 1:NP_649757.1 Gene:CG2767 FlyBaseID:FBgn0037537 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_506322.1 Gene:F53F1.2 WormBaseID:WBGene00009980 Length:297 Species:Caenorhabditis elegans

Alignment Length:297 Identity:102/298 (34%)
Similarity:148/298 (50%) Gaps:32/298 (11%)


  Fly    10 NNGEKMPVIGIGTWQASDEEIETAIDAALEAGYRHIDTAPVYGNEKAIGRVLKRWLDAGKVKREE 74
            |:|..:|.:|.||::.:.|.:..||||||.||||..|||..|.|||.:|..||..|....:.|.:
 Worm    16 NSGYNIPFVGFGTYKVTGENVPPAIDAALTAGYRMFDTAKYYLNEKELGEALKILLPKHGLSRSD 80

  Fly    75 LFIVTKVPPVSNRPHEV-EPTIKKSLEDLQLDYVDLYLVHTPFTININEDGSFKLDKEGLMEVDV 138
            :|:.:|..|.|....|. ...:::||:.||.||:|:||||.|              |....:.|.
 Worm    81 VFLTSKFFPESKNCREACRGFVEESLQSLQTDYIDMYLVHYP--------------KPNDSDNDD 131

  Fly   139 TTNHAAIWVAMEALVE---KGLTKSIGVSNFSKDQVARLLKNCKIRPANNQIEHHVYLQQRDLVD 200
            ..|.....:|.|.|.|   .|..:||||||:....:..|....|:.|..||:|:|.:..:..|..
 Worm   132 VNNAEYRKIAYEVLEEAKAAGKVRSIGVSNYEIVHLEELKTYAKVPPCANQLEYHPHFARIPLQK 196

  Fly   201 FCKSENITVTAYSPLGSKGIAKFNAGAGIVRDLPDLMDIPEVKEIAASHGKTPAQVLLRWIIDTG 265
            :||.:||...|:|.|              .|..|.|::.|.|.|:|..|..:...|||.|.:...
 Worm   197 YCKEKNIFFQAFSSL--------------ARHEPKLIEDPVVVELAKKHNTSVPLVLLAWALRQN 247

  Fly   266 VSAIPKSTNPARLKQNLDVFDFELTAEEVAKLSSLDQ 302
            |..:|||..|:|:.:|..|.|..||.|::..|::||:
 Worm   248 VGIVPKSVTPSRIVENFKVIDIALTPEDIQSLTALDR 284

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2767NP_649757.1 ARA1 5..302 CDD:223729 102/296 (34%)
Tas 10..297 CDD:223739 99/291 (34%)
F53F1.2NP_506322.1 ARA1 14..293 CDD:223729 102/298 (34%)
Tas 16..281 CDD:223739 100/293 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1770
TreeFam 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.