DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2767 and ZC443.1

Sequence 1:NP_649757.1 Gene:CG2767 FlyBaseID:FBgn0037537 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_506205.1 Gene:ZC443.1 WormBaseID:WBGene00013896 Length:320 Species:Caenorhabditis elegans

Alignment Length:324 Identity:130/325 (40%)
Similarity:188/325 (58%) Gaps:18/325 (6%)


  Fly     8 TFNNGEKMPVIGIGTWQASDEEIETAIDAALEAGYRHIDTAPVYGNEKAIGRVLKRWLDAGKVKR 72
            |.:||..||.||:||||.:.||.:|.|..|:.|||||||||.:|.||..||..|......|.:||
 Worm     9 TLSNGVLMPSIGLGTWQMTGEEGKTVIRNAVLAGYRHIDTATLYQNEHQIGDALAELFAEGILKR 73

  Fly    73 EELFIVTKVPPVSNRPHEVEPTIKKSLEDLQLDYVDLYLVHTPFTININEDGSFKLDKEGLMEVD 137
            |::||.||.......|..||..::.||:.|:||||||||.|.|  .:..:||||:.|    ::|:
 Worm    74 EDIFITTKAFCHEVAPDVVEEALRNSLKRLRLDYVDLYLAHIP--ASTKDDGSFRSD----VKVE 132

  Fly   138 VTTNHAAIWVAMEALVEKGLTKSIGVSNFSKDQVARLLKNCKIRPANNQIEHHVYLQQRDLVDFC 202
                  .||...|.:...||||:||||||::.|:.|::...|:....:|:|.|:||.|:...:.|
 Worm   133 ------DIWRGFEKVYGLGLTKAIGVSNFNESQIVRIMNIQKVPIHASQLELHLYLPQKAHRELC 191

  Fly   203 KSENITVTAYSPLGSKGIAKFNAGAG-----IVRDLPDLMDIPEVKEIAASHGKTPAQVLLRWII 262
            |..||.:|||:.|||.|........|     ..::..:.|:...||.:|..:.|||||:|||..:
 Worm   192 KKHNILITAYATLGSPGRMSVVGSNGRPLFESTQNSENEMNDKHVKALAQKYSKTPAQILLRATV 256

  Fly   263 DTGVSAIPKSTNPARLKQNLDVFDFELTAEEVAKLSSLDQNIRICDFAFFHGVERHPEFTFKNQ 326
            :.|:..|||:|||.|:|:|:::|||.::..||..|.:.::..:...| ::..|..|||..|..|
 Worm   257 EMGIIVIPKTTNPERMKENINIFDFNISNAEVNLLEAHERTKQERLF-WWPNVADHPEDPFATQ 319

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2767NP_649757.1 ARA1 5..302 CDD:223729 123/299 (41%)
Tas 10..297 CDD:223739 121/292 (41%)
ZC443.1NP_506205.1 ARA1 6..305 CDD:223729 124/309 (40%)
Tas 13..293 CDD:223739 121/292 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H105824
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S1517
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1016440at2759
OrthoFinder 1 1.000 FOG0000053
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11732
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
76.920

Return to query results.
Submit another query.