DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2767 and ZC443.1

DIOPT Version :9

Sequence 1:NP_649757.1 Gene:CG2767 / 40946 FlyBaseID:FBgn0037537 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_506205.1 Gene:ZC443.1 / 179756 WormBaseID:WBGene00013896 Length:320 Species:Caenorhabditis elegans


Alignment Length:324 Identity:130/324 - (40%)
Similarity:188/324 - (58%) Gaps:18/324 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 TFNNGEKMPVIGIGTWQASDEEIETAIDAALEAGYRHIDTAPVYGNEKAIGRVLKRWLDAGKVKR 72
            |.:||..||.||:||||.:.||.:|.|..|:.|||||||||.:|.||..||..|......|.:||
 Worm     9 TLSNGVLMPSIGLGTWQMTGEEGKTVIRNAVLAGYRHIDTATLYQNEHQIGDALAELFAEGILKR 73

  Fly    73 EELFIVTKVPPVSNRPHEVEPTIKKSLEDLQLDYVDLYLVHTPFTININEDGSFKLDKEGLMEVD 137
            |::||.||.......|..||..::.||:.|:||||||||.|.|  .:..:||||:.|    ::|:
 Worm    74 EDIFITTKAFCHEVAPDVVEEALRNSLKRLRLDYVDLYLAHIP--ASTKDDGSFRSD----VKVE 132

  Fly   138 VTTNHAAIWVAMEALVEKGLTKSIGVSNFSKDQVARLLKNCKIRPANNQIEHHVYLQQRDLVDFC 202
                  .||...|.:...||||:||||||::.|:.|::...|:....:|:|.|:||.|:...:.|
 Worm   133 ------DIWRGFEKVYGLGLTKAIGVSNFNESQIVRIMNIQKVPIHASQLELHLYLPQKAHRELC 191

  Fly   203 KSENITVTAYSPLGSKGIAKFNAGAG-----IVRDLPDLMDIPEVKEIAASHGKTPAQVLLRWII 262
            |..||.:|||:.|||.|........|     ..::..:.|:...||.:|..:.|||||:|||..:
 Worm   192 KKHNILITAYATLGSPGRMSVVGSNGRPLFESTQNSENEMNDKHVKALAQKYSKTPAQILLRATV 256

  Fly   263 DTGVSAIPKSTNPARLKQNLDVFDFELTAEEVAKLSSLDQNIRICDFAFFHGVERHPEFTFKNQ 326
            :.|:..|||:|||.|:|:|:::|||.::..||..|.:.::..:...| ::..|..|||..|..|
 Worm   257 EMGIIVIPKTTNPERMKENINIFDFNISNAEVNLLEAHERTKQERLF-WWPNVADHPEDPFATQ 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2767NP_649757.1 ARA1 5..302 CDD:223729 123/298 (41%)
Tas 10..297 CDD:223739 121/291 (42%)
ZC443.1NP_506205.1 AKR_AKR1G1_CeAKR 5..303 CDD:381380 123/305 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H105824
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1517
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.780

Return to query results.
Submit another query.