DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2767 and Akr1c3

Sequence 1:NP_649757.1 Gene:CG2767 FlyBaseID:FBgn0037537 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_612519.1 Gene:Akr1c3 RGDID:708428 Length:323 Species:Rattus norvegicus

Alignment Length:334 Identity:122/335 (36%)
Similarity:198/335 (59%) Gaps:19/335 (6%)


  Fly     2 VNTKF--LTFNNGEKMPVIGIGTWQASDEEIE----TAIDAALEAGYRHIDTAPVYGNEKAIGRV 60
            :|:|.  :..|:|..:||:|.||: |::|.:.    .:...|::.|:||||.:.:|.||:.||:.
  Rat     1 MNSKIQKMELNDGHSIPVLGFGTY-ATEENLRKKSMESTKIAIDVGFRHIDCSHLYQNEEEIGQA 64

  Fly    61 LKRWLDAGKVKREELFIVTKVPPVSNRPHEVEPTIKKSLEDLQLDYVDLYLVHTPFTININEDGS 125
            :...::.|.||||::|..:|:...|:||..|.|:::.||..|.||||||||:|.|.::... |..
  Rat    65 IVSKIEDGTVKREDIFYTSKLWSTSHRPELVRPSLENSLRKLNLDYVDLYLIHFPVSLKPG-DEL 128

  Fly   126 FKLDKEGLMEVDVTTNHAAIWVAMEALVEKGLTKSIGVSNFSKDQVARLLK--NCKIRPANNQIE 188
            ...|:.|.:.:| |.:....|.|||...:.||.||||||||::.|:.::|.  ..|.||..||:|
  Rat   129 LPQDEHGNLILD-TVDLCDTWEAMEKCKDAGLAKSIGVSNFNRRQLEKILNKPGLKHRPVCNQVE 192

  Fly   189 HHVYLQQRDLVDFCKSENITVTAYSPLGSKGIAKFNAGAGIVRDLPDLMDIPEVKEIAASHGKTP 253
            .|:||.|..|:.:||..:|.:.||..||::.. |:    .|..|.|.|:|.|.:..:|..:.:||
  Rat   193 CHLYLNQSKLLAYCKMNDIVLVAYGALGTQRY-KY----CINEDTPVLLDDPILCTMAKKYKRTP 252

  Fly   254 AQVLLRWIIDTGVSAIPKSTNPARLKQNLDVFDFELTAEEVAKLSSLDQNIRICDFAFFHGVERH 318
            |.:.||:.::.|:..:.||.|..|:::||.||||:|.::::..|.:||:|:|......|   :.|
  Rat   253 ALIALRYQLERGIVTLVKSFNEERIRENLQVFDFQLASDDMEILDNLDRNLRYFPANMF---KAH 314

  Fly   319 PEFTFKNQY 327
            |.|.|.::|
  Rat   315 PNFPFSDEY 323

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2767NP_649757.1 ARA1 5..302 CDD:223729 113/305 (37%)
Tas 10..297 CDD:223739 109/293 (37%)
Akr1c3NP_612519.1 ARA1 7..310 CDD:223729 114/311 (37%)
Tas 15..297 CDD:223739 108/290 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1016440at2759
OrthoFinder 1 1.000 FOG0000053
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11732
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.