DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2767 and Akr1b7

Sequence 1:NP_649757.1 Gene:CG2767 FlyBaseID:FBgn0037537 Length:329 Species:Drosophila melanogaster
Sequence 2:XP_008760977.1 Gene:Akr1b7 RGDID:620257 Length:324 Species:Rattus norvegicus

Alignment Length:319 Identity:123/320 (38%)
Similarity:189/320 (59%) Gaps:29/320 (9%)


  Fly    16 PVIGIGTWQASDEEIETAIDAALEAGYRHIDTAPVYGNEKAIGRVLKRWLDAGKVKREELFIVTK 80
            |::....:|:...:::.|:.||::|||||.|.|.||.||..:|..::..:....|:||:||||:|
  Rat    22 PMVFSIAFQSPPGQVKEAVKAAIDAGYRHFDCAYVYQNESEVGEAIQEKIKEKAVRREDLFIVSK 86

  Fly    81 VPPVSNRPHEVEPTIKKSLEDLQLDYVDLYLVHTPFTININEDGSFKLDKEGLMEVDVTTNHAAI 145
            :.........::...:|:|.||:|||:||||:|.|..:...::...| |.:|.:.:..:|...| 
  Rat    87 LWSTFFEKSLMKEAFQKTLSDLKLDYLDLYLIHWPQGLQAGKEFLPK-DSQGKVLMSKSTFLDA- 149

  Fly   146 WVAMEALVEKGLTKSIGVSNFSKDQVARLLK--NCKIRPANNQIEHHVYLQQRDLVDFCKSENIT 208
            |..||.||::||.|::|||||:..|:.|||.  ..|.:|..||:|.|.||.|..|:.:|.|:.|.
  Rat   150 WEGMEELVDQGLVKALGVSNFNHFQIERLLNKPGLKHKPVTNQVECHPYLTQEKLIQYCHSKGIA 214

  Fly   209 VTAYSPLGS--KGIAKFNAGAGIVRDLPDLMDIPEVKEIAASHGKTPAQVLLRWIIDTGVSAIPK 271
            |.|||||||  :..||        .:.|.:::||::|||||.|.||.||||:|:.:...|:.|||
  Rat   215 VIAYSPLGSPDRPYAK--------PEDPVVLEIPKIKEIAAKHKKTIAQVLIRFHVQRNVAVIPK 271

  Fly   272 STNPARLKQNLDVFDFELTAEEVAKLSSLDQNIRIC---------DFAFFHGVERHPEF 321
            |...:.:|:|:.||||:|:.|::|.:.||::|.|.|         ||.|      |.|:
  Rat   272 SVTLSHIKENIQVFDFQLSEEDMAAILSLNRNWRACGLFVTSDEEDFPF------HEEY 324

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2767NP_649757.1 ARA1 5..302 CDD:223729 115/290 (40%)
Tas 10..297 CDD:223739 113/285 (40%)
Akr1b7XP_008760977.1 ARA1 29..320 CDD:223729 119/301 (40%)
Tas 37..297 CDD:223739 111/270 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1016440at2759
OrthoFinder 1 1.000 FOG0000053
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11732
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.