DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2767 and Akr1c14

Sequence 1:NP_649757.1 Gene:CG2767 FlyBaseID:FBgn0037537 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_598833.1 Gene:Akr1c14 MGIID:2145458 Length:323 Species:Mus musculus

Alignment Length:336 Identity:108/337 (32%)
Similarity:184/337 (55%) Gaps:35/337 (10%)


  Fly     7 LTFNNGEKMPVIGIGTW---QASDEEIETAIDAALEAGYRHIDTAPVYGNEKAIGRVLKRWLDAG 68
            :..|:|..:|.:|.||.   :...:|:..|...|::.|:||.|:|.:|..|:.:|:.::..::.|
Mouse     8 VVLNDGHFIPALGFGTTVPDKVPKDELIKATKIAIDTGFRHFDSAYLYQIEEEVGQAIRSKIEDG 72

  Fly    69 KVKREELFIVTKVPPVSNRPHEVEPTIKKSLEDLQLDYVDLYLVHTPFTININEDGSFKLDKEGL 133
            .||||::|..:|:....:||..|...::|:|::.||||||||::|.|..:... |..|..|:.|.
Mouse    73 TVKREDIFYTSKLWSTFHRPELVRSCLEKTLKNAQLDYVDLYIIHFPMALQPG-DKLFPRDEHGK 136

  Fly   134 M---EVDVTTNHAAIWVAMEALVEKGLTKSIGVSNFSKDQVARLLK--NCKIRPANNQIEHHVYL 193
            :   .||:...    |.|||...:.||.||||||||:..|:..:|.  ..|.:|..||:|.|:||
Mouse   137 LLAEAVDLCDT----WEAMEKCKDAGLAKSIGVSNFNFRQLETILNKPGLKYKPVCNQVECHLYL 197

  Fly   194 QQRDLVDFCKSENITVTAYSPLGSKGIAKFNAGAGIVRD-------LPDLMDIPEVKEIAASHGK 251
            .|..::|:|||::|.:.:|..|||.            ||       .|.|:|.|.:..:|..:.:
Mouse   198 NQSQMLDYCKSKDIILVSYCTLGSS------------RDKIWVDQKSPVLLDDPVLCAMANKYKQ 250

  Fly   252 TPAQVLLRWIIDTGVSAIPKSTNPARLKQNLDVFDFELTAEEVAKLSSLDQNIRICDFAFFHGVE 316
            |||.:.:|:.:..|:..:.:|....|:|:.:.||:|:|.:|::..|..|.:|:|....::|   :
Mouse   251 TPALIAIRYQLQRGIVVLTRSFKEKRIKEFMKVFEFQLASEDMKVLDGLHRNLRYNTASYF---D 312

  Fly   317 RHPEFTFKNQY 327
            .||...|.::|
Mouse   313 DHPNHPFTDEY 323

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2767NP_649757.1 ARA1 5..302 CDD:223729 101/310 (33%)
Tas 10..297 CDD:223739 99/302 (33%)
Akr1c14NP_598833.1 ARA1 3..305 CDD:223729 103/314 (33%)
Tas 7..302 CDD:223739 101/311 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1016440at2759
OrthoFinder 1 1.000 FOG0000053
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11732
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.