DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2767 and LOC101733893

Sequence 1:NP_649757.1 Gene:CG2767 FlyBaseID:FBgn0037537 Length:329 Species:Drosophila melanogaster
Sequence 2:XP_012810719.2 Gene:LOC101733893 ID: Length:253 Species:Xenopus tropicalis

Alignment Length:253 Identity:95/254 (37%)
Similarity:141/254 (56%) Gaps:20/254 (8%)


  Fly    10 NNGEKMPVIGIGTW-------QASDEEIETAIDAALEAGYRHIDTAPVYGNEKAIGRVLKRWLDA 67
            |:|.||||:|.||:       ..::|..:.|||    .||||||.|.:||||..:||.:|..:..
 Frog    12 NDGHKMPVLGFGTYAPEKFPKSLAEEGTKVAID----VGYRHIDCAFIYGNEVEVGRAIKAKIAD 72

  Fly    68 GKVKREELFIVTKVPPVSNRPHEVEPTIKKSLEDLQLDYVDLYLVHTPFTININEDGSFKLDKEG 132
            |.||||::|...|:....:.|..|.|.::|||.||||||:||:::|.|......:| ...||:.|
 Frog    73 GTVKREDVFYTGKLWSTFHTPERVRPALEKSLTDLQLDYMDLFIIHNPVEFKPGDD-PLPLDENG 136

  Fly   133 LMEVDVTTNHAAIWVAMEALVEKGLTKSIGVSNFSKDQVARLLK--NCKIRPANNQIEHHVYLQQ 195
             ..:...|:....|.|:|...:.||.:|||||||:..|:..:|.  ..|.:|..||::.|:||.|
 Frog   137 -KPIFHNTDLRDTWKALEKCKDAGLVRSIGVSNFNHKQLELILNMPGLKYKPVCNQVKCHIYLDQ 200

  Fly   196 RDLVDFCKSENITVTAYSPLGSKGIAKFNAGAGIVRDLPDLMDIPEVKEIAASHGKTP 253
            ..|::||||::|.:.||..|||.....:     :.:..|.|::...:..||..|.:||
 Frog   201 SKLLEFCKSKDIVLVAYGVLGSSREENW-----VDQSTPVLLENTILGAIAKQHNRTP 253

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2767NP_649757.1 ARA1 5..302 CDD:223729 95/254 (37%)
Tas 10..297 CDD:223739 95/254 (37%)
LOC101733893XP_012810719.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000053
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.