DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2767 and akr1c1

Sequence 1:NP_649757.1 Gene:CG2767 FlyBaseID:FBgn0037537 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_001354926.1 Gene:akr1c1 XenbaseID:XB-GENE-5895911 Length:356 Species:Xenopus tropicalis

Alignment Length:354 Identity:130/355 (37%)
Similarity:200/355 (56%) Gaps:50/355 (14%)


  Fly     7 LTFNNGEKMPVIGIGTW---------QASD---------------EEIETAIDAALEAGYRHIDT 47
            :..::|..|||:..||:         ||:.               :::..|...||:.||||:|.
 Frog    20 IQLHDGRWMPVVAFGTFYPFTFPGDSQANPGHCAGTKHGTEKSFIDDVRVATKMALDLGYRHVDG 84

  Fly    48 APVYGNEKAIGRVLKRWLDAGKVKREELFIVTKVPPVSNRPHEVEPTIKKSLEDLQLDYVDLYLV 112
            |.:|.:|..:|:..:.....|.:|||:||..:|:....::||.|.|.::|:|..||:|||||||:
 Frog    85 AFLYSSETGVGQAFREKFADGTLKREDLFYTSKLWNTFHQPHLVRPALEKTLSFLQMDYVDLYLI 149

  Fly   113 HTPFTIN-------INEDGSFKLDKEGLMEVDVTTNHAAIWVAMEALVEKGLTKSIGVSNFSKDQ 170
            |.|.:..       .||||:...|:..|::.         |.|:|...:.||.||||||||::.|
 Frog   150 HMPMSFKPAEELFPKNEDGTCAFDQPDLLQT---------WQALEECRDAGLVKSIGVSNFNRRQ 205

  Fly   171 VARLLK--NCKIRPANNQIEHHVYLQQRDLVDFCKSENITVTAYSPLGSKGIAKFNAGAGIVRDL 233
            :..:|.  ..|.:|..||||.|.||.|:.:::||||::|.|.||..|||.|     ||..:.:..
 Frog   206 LEMILNKPGLKYKPVCNQIECHPYLNQKQMLEFCKSKDIVVVAYGVLGSPG-----AGKWVDQSC 265

  Fly   234 PDLMDIPEVKEIAASHGKTPAQVLLRWIIDTGVSAIPKSTNPARLKQNLDVFDFELTAEEVAKLS 298
            |.|::.|.:..|...:.|:||||.:|::|..|..||.||.||.|:||||:||||:|:.||:|.:.
 Frog   266 PILLEDPVLISIGQKYSKSPAQVSMRYMIQRGCVAIAKSFNPDRMKQNLEVFDFQLSQEEMAAID 330

  Fly   299 SLDQNIRICDFAFFHGVERHPEFTFKNQY 327
            .|::|:|...|:.:   |:||::.|.:||
 Frog   331 GLNKNMRYWSFSEW---EKHPQYPFHSQY 356

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2767NP_649757.1 ARA1 5..302 CDD:223729 121/328 (37%)
Tas 10..297 CDD:223739 120/320 (38%)
akr1c1NP_001354926.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1016440at2759
OrthoFinder 1 1.000 FOG0000053
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.