DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10445 and RAD16

Sequence 1:NP_001246974.1 Gene:CG10445 FlyBaseID:FBgn0037531 Length:945 Species:Drosophila melanogaster
Sequence 2:NP_009672.1 Gene:RAD16 SGDID:S000000318 Length:790 Species:Saccharomyces cerevisiae

Alignment Length:985 Identity:207/986 (21%)
Similarity:384/986 (39%) Gaps:311/986 (32%)


  Fly    51 EYADNESAIFVSASEYNEKKAQIDQLVQKILTMEQQQRQLEENASETKELCDLKLHLEKLNARLE 115
            |.:|:::|:      .|.|..|:....:.:  .:.|..:..::|:..|...|     :..:..::
Yeast    23 ELSDDDTAV------KNSKTLQLKGNSENV--NDSQDEEYRDDATLVKSPDD-----DDKDFIID 74

  Fly   116 ALGEFLDTLRLREDQQEIKIEDNSELVDHTEQPKWSNLYSGLNR-----YRQKANHTAA------ 169
            ..|...:.....|:...|| .||.|:::..|:...|:....|.:     .|:|...|:.      
Yeast    75 LTGSDKERTATDENTHAIK-NDNDEIIEIKEERDVSDDDEPLTKKRKTTARKKKKKTSTKKKSPK 138

  Fly   170 ---------QFYQHK---SNIIDSLKTLYEPIQPRPAIDDLEKQPALLLVRLLKHQQSCLKWMQF 222
                     :.|:|.   .|:...||      ...|.:....|||..:.::||..|...|.|:..
Yeast   139 VTPYERNTLRLYEHHPELRNVFTDLK------NAPPYVPQRSKQPDGMTIKLLPFQLEGLHWLIS 197

  Fly   223 RERQKISGGILADDMGLGKTLSMIALILASEETKNRKREEKKKALTLKWTQEFNRVYCKEIRKIS 287
            :|....:||:|||:||:|||:..|||::                                     
Yeast   198 QEESIYAGGVLADEMGMGKTIQTIALLM------------------------------------- 225

  Fly   288 MFDDEEESGKEEEQYEPPEKRTCHVKTKKINQFRILDDDDNDAGDKAVVEDEQKDLLAKTPEPEV 352
                                                    ||              |.|:|    
Yeast   226 ----------------------------------------ND--------------LTKSP---- 232

  Fly   353 FSSDEEEEHLSNGRYPSANTLVVCPMSVMCQWAHEVASKVAQNAIRVLTFHGPNRHEIGIEAFRS 417
                               :|||.|...:.||.:|: .:..:..:::..:||.:| ...|:..:.
Yeast   233 -------------------SLVVAPTVALMQWKNEI-EQHTKGQLKIYIYHGASR-TTDIKDLQG 276

  Fly   418 YDLVITSYNLVVNELKR--YG---------NTSPLFAVYWNRVILDEAHIIRNSKTNCCNSVCQL 471
            ||:|:|:|.::.:..::  ||         ..|.|..:.:.||||||||.|::.::|...:|..|
Yeast   277 YDVVLTTYAVLESVFRKQNYGFRRKNGLFKQPSVLHNIDFYRVILDEAHNIKDRQSNTARAVNNL 341

  Fly   472 RAHCHWALTGTPVQNRGVDVFALLRFVNVPNFQDL---------QQWK----------------- 510
            :....|.|:|||:|||..::::|:||:|:..|...         :.||                 
Yeast   342 KTQKRWCLSGTPLQNRIGEMYSLIRFLNINPFTKYFCTKCDCASKDWKFTDRMHCDHCSHVIMQH 406

  Fly   511 ---------KNLNE------SMLGHRRLNFIIKPLMLRRTKQKLQASGDMPALPSLKIELICVQ- 559
                     ||:.:      .:.....:..::|.:|||||  |::.:.|:...|    .::.|: 
Yeast   407 TNFFNHFMLKNIQKFGVEGPGLESFNNIQTLLKNIMLRRT--KVERADDLGLPP----RIVTVRR 465

  Fly   560 --LSKTEMAVYQILSAISKKIFTQFLLQREKGNSDLNYYSLERTPQFIAGHMSDERYNEIYERFL 622
              .::.|..:|:.|...||:.:..|:   |:|....||.:                         
Yeast   466 DFFNEEEKDLYRSLYTDSKRKYNSFV---EEGVVLNNYAN------------------------- 502

  Fly   623 KSLGYNPGEKILGIYILVLLLRLRQFCCHPGLMIGMLRGALTAEDVQNVKVDASDVEGQ------ 681
                           |..|:.|:||...||.|::..|.. ...:|:..|.....:.|.:      
Yeast   503 ---------------IFTLITRMRQLADHPDLVLKRLNN-FPGDDIGVVICQLCNDEAEEPIESK 551

  Fly   682 -----LKMDVLAELDKFDETDSEDDC--CDEEDSTRRDGNFKLEVIKDEIKEENVPWDSGDDLPT 739
                 .::.:...::.|.|.:::..|  |          :..|.:                || :
Yeast   552 CHHKFCRLCIKEYVESFMENNNKLTCPVC----------HIGLSI----------------DL-S 589

  Fly   740 ASSFEDQLDSARALKLLNPQNPIFQFIRPSAKLKMVIDKLEELLTGTND-KIIVTSQWVSYLAIV 803
            ..:.|..|||.:...:::..|...:: :.|.|::.::::|.:|.:.... |.||.||:.|.|.:|
Yeast   590 QPALEVDLDSFKKQSIVSRLNMSGKW-QSSTKIEALVEELYKLRSNKRTIKSIVFSQFTSMLDLV 653

  Fly   804 RKRLQDLSWETLDFNGQLTAKEREIVLRDFNANNEKRVLLLSLTAGGVGLNLNVANHMLIVDLHW 868
            ..||:...::|:...|.::..:|:..::.|..|.:..|.|:||.||||.|||..|:.:.|:|..|
Yeast   654 EWRLKRAGFQTVKLQGSMSPTQRDETIKYFMNNIQCEVFLVSLKAGGVALNLCEASQVFILDPWW 718

  Fly   869 NPQLERQAQDRIYRYGQTKPTFIYRYMCQDTVEQRIKSLQDCKLEIAKVVLPEEGGEVTKCVGGG 933
            ||.:|.|:.||::|.||.:|..|.|:..:|::|.||..||:.|..:....:.::...:::     
Yeast   719 NPSVEWQSGDRVHRIGQYRPVKITRFCIEDSIEARIIELQEKKANMIHATINQDEAAISR----- 778

  Fly   934 LNLAELKKLF 943
            |..|:|:.||
Yeast   779 LTPADLQFLF 788

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10445NP_001246974.1 SNF2_N 212..655 CDD:278600 99/498 (20%)
DEXDc <372..483 CDD:238005 36/122 (30%)
HELICc 761..892 CDD:238034 45/132 (34%)
RAD16NP_009672.1 HepA <55..788 CDD:223627 199/944 (21%)
RAD18 537..>642 CDD:333230 19/133 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0141
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S3486
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T133819
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2250
TreeFam 00.000 Not matched by this tool.
43.880

Return to query results.
Submit another query.