DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10445 and RAD5

Sequence 1:NP_001246974.1 Gene:CG10445 FlyBaseID:FBgn0037531 Length:945 Species:Drosophila melanogaster
Sequence 2:NP_013132.1 Gene:RAD5 SGDID:S000004022 Length:1169 Species:Saccharomyces cerevisiae

Alignment Length:1097 Identity:256/1098 (23%)
Similarity:445/1098 (41%) Gaps:364/1098 (33%)


  Fly    30 SSGEINNWMEPEPVDSLELSGEYADNE-----------------SAIFVSASEYNEKKAQIDQLV 77
            ||.||          |.|::..:.||:                 |.||       |::...:.|:
Yeast   255 SSHEI----------SFEVTLIFCDNKRLSIGDSFILQLDCFLTSLIF-------EERNDGESLM 302

  Fly    78 QKILTMEQQQRQLEENASETKELCDLKLHLEKLNARLEALGEFLDTLRLRE--DQQEI----KIE 136
            ::..|....:|: ::|.:..:.|.:....||..:.|| ||.:..|.|||:.  |:|:.    |||
Yeast   303 KRRRTEGGNKRE-KDNGNFGRTLTETDEELESRSKRL-ALLKLFDKLRLKPILDEQKALEKHKIE 365

  Fly   137 DNS--ELVDHTEQPKWSNLYSGLNRYRQKANHTAAQFYQHKSNIIDSLKTLYEPIQPRPAIDDL- 198
            .||  |::|.......||..:.::...:...|      :.::..::.|||.|:..|...::..| 
Yeast   366 LNSDPEIIDLDNDEICSNQVTEVHNNLRDTQH------EEETMNLNQLKTFYKAAQSSESLKSLP 424

  Fly   199 EKQPA--LLLVRLLKHQQSCLKWMQFRERQ----------------------------------- 226
            |.:|:  :..:.|..:|:..|.||..||::                                   
Yeast   425 ETEPSRDVFKLELRNYQKQGLTWMLRREQEFAKAASDGEASETGANMINPLWKQFKWPNDMSWAA 489

  Fly   227 ----------------------------------KISGGILADDMGLGKTLSMIALILASEETKN 257
                                              .|.||||:|:||||||::..:|:|:      
Yeast   490 QNLQQDHVNVEDGIFFYANLHSGEFSLAKPILKTMIKGGILSDEMGLGKTVAAYSLVLS------ 548

  Fly   258 RKREEKKKALTLKWTQEFNRVYCKEIRKISMFDDEEESGKEEEQYEPPEKRTCHVKTKKINQFRI 322
                                  |..                                        
Yeast   549 ----------------------CPH---------------------------------------- 551

  Fly   323 LDDDDNDAGDKAVVEDEQ---KDLLAKTPEPEVFSSDEEEEHLSNGRYPSANTLVVCPMSVMCQW 384
                |:|..||.:.:.|.   .|.|     |..:..:::.       |.|..||:|.|||::.||
Yeast   552 ----DSDVVDKKLFDIENTAVSDNL-----PSTWQDNKKP-------YASKTTLIVVPMSLLTQW 600

  Fly   385 AHEVASKVAQNAIRVLTFHGPNR-HEI----GIEAFRSY--------DLVITSYNLVVNELKRYG 436
            ::|...  |.|:        |:. ||:    .:.:.::.        .:|:|:|.:|.||..::.
Yeast   601 SNEFTK--ANNS--------PDMYHEVYYGGNVSSLKTLLTKTKTPPTVVLTTYGIVQNEWTKHS 655

  Fly   437 N----------TSPLFAVYWNRVILDEAHIIRNSKTNCCNSVCQLRAHCHWALTGTPVQNRGVDV 491
            .          :|.||:|.:.|:|:||.|.|||..|....:|..|:..|.|.|||||:.||..|:
Yeast   656 KGRMTDEDVNISSGLFSVNFYRIIIDEGHNIRNRTTVTSKAVMALQGKCKWVLTGTPIINRLDDL 720

  Fly   492 FALLRFVNVPNFQDLQQWK---------KNLNESMLGHRRLNFIIKPLMLRRTKQKLQASGDMPA 547
            ::|::|:.:..::.:..||         ||..::.   ..:|.|::|::||||||.....|..  
Yeast   721 YSLVKFLELDPWRQINYWKTFVSTPFESKNYKQAF---DVVNAILEPVLLRRTKQMKDKDGKP-- 780

  Fly   548 LPSLKIELICVQLSKTEMAVYQILSAISKKIFTQFLLQREKGNSDLNYYSLERTPQFIAGHMSDE 612
                     .|:|...|:.:.::..:.|:.:..:|||.:.                         
Yeast   781 ---------LVELPPKEVVIKRLPFSKSQDLLYKFLLDKA------------------------- 811

  Fly   613 RYNEIYERFLKSLGYNPGEKILGIY--ILVLLLRLRQFCCHPGLMIGMLRGALTAEDVQNVKVDA 675
                  |..:|| |...|: :|..|  |||.:|||||.||||||:     |:....|....|.:.
Yeast   812 ------EVSVKS-GIARGD-LLKKYSTILVHILRLRQVCCHPGLI-----GSQDENDEDLSKNNK 863

  Fly   676 SDVEGQLKMDVLAEL--DKFDETDSED----------------------DC--CDEEDS------ 708
            ...|..:::|.|..:  ::||.:.|::                      :|  |..|..      
Yeast   864 LVTEQTVELDSLMRVVSERFDNSFSKEELDAMIQRLKVKYPDNKSFQSLECSICTTEPMDLDKAL 928

  Fly   709 -TRRDGNFKLEVIKDEIKEENVPWDSGDDLPTASSFEDQLDSARALKLL----NPQNPIFQFIRP 768
             |....:|..:.:.:.|:.:|.. :.|...|..   .:|:|:.|.|.|:    |.:|..|:...|
Yeast   929 FTECGHSFCEKCLFEYIEFQNSK-NLGLKCPNC---RNQIDACRLLALVQTNSNSKNLEFKPYSP 989

  Fly   769 SAKLKMVIDKLEELL----TGTNDKIIVTSQWVSYLAIVRKRL-----QDLSWETLDFNGQLTAK 824
            ::|...:...|:||.    :...:::::.||:.:||.|:.|.|     :|:: :...|:|:|:.|
Yeast   990 ASKSSKITALLKELQLLQDSSAGEQVVIFSQFSTYLDILEKELTHTFSKDVA-KIYKFDGRLSLK 1053

  Fly   825 EREIVLRDFNAN--NEKRVLLLSLTAGGVGLNLNVANHMLIVDLHWNPQLERQAQDRIYRYGQTK 887
            ||..||.||...  :.:::|||||.||||||||..|:|..::|..|:|.:|.||.||::|.|||.
Yeast  1054 ERTSVLADFAVKDYSRQKILLLSLKAGGVGLNLTCASHAYMMDPWWSPSMEDQAIDRLHRIGQTN 1118

  Fly   888 PTFIYRYMCQDTVEQRIKSLQDCKLEIAKVVLPEEGGEVTKCVGGGLNLAELKKLFE 944
            ...:.|::.||::|:::..:|:.|..|.:.:..:|.....:      .:.|::.|||
Yeast  1119 SVKVMRFIIQDSIEEKMLRIQEKKRTIGEAMDTDEDERRKR------RIEEIQMLFE 1169

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10445NP_001246974.1 SNF2_N 212..655 CDD:278600 120/549 (22%)
DEXDc <372..483 CDD:238005 41/134 (31%)
HELICc 761..892 CDD:238034 51/142 (36%)
RAD5NP_013132.1 HepA 116..1169 CDD:223627 255/1096 (23%)
zf-C3HC4 914..960 CDD:306580 9/47 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T133819
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2250
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.