DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10445 and TTF2

Sequence 1:NP_001246974.1 Gene:CG10445 FlyBaseID:FBgn0037531 Length:945 Species:Drosophila melanogaster
Sequence 2:XP_016858039.1 Gene:TTF2 HGNCID:12398 Length:1190 Species:Homo sapiens

Alignment Length:1033 Identity:289/1034 (28%)
Similarity:448/1034 (43%) Gaps:281/1034 (27%)


  Fly     2 ESSSPSDTTEIHKQSCSIQDQSSVPVPDSSGE---INNWMEPEPVDSLELSGEYADNESAIFVS- 62
            |:::.||..|         :...|.|....|.   .::.::.|..::|    ::.|......|| 
Human   346 EAATSSDDEE---------EDDVVFVSSKPGSPLLFDSTLDLETKENL----QFPDRSVQRKVSP 397

  Fly    63 ASEYNEKKAQIDQLVQKI-LTMEQQQRQLEENASETKELCDLKLHLEKLNARLEALGEFLDTLRL 126
            ||..::|....|.:.::: ||.:.:|::....:...:.|.|..   :||..:::.|.|.|..|.|
Human   398 ASGVSKKVEPSDPVARRVYLTTQLKQKKSTLASVNIQALPDKG---QKLIKQIQELEEVLSGLTL 459

  Fly   127 REDQ-----QEIKIEDNSELVDHTEQPKW-------------------------------SNLYS 155
            ..:|     ...::...|.....|..|..                               |..|.
Human   460 SPEQGTNEKSNSQVPQQSHFTKTTTGPPHLVPPQPLPRRGTQPVGSLELKSACQVTAGGSSQCYR 524

  Fly   156 GLNRYRQKANHTAAQFYQHKSNII--DSLKTLYEPIQPRPAIDDLEKQPALLLVRLLKHQQSCLK 218
            | |.|.. |.|| .|.:.|....|  :::..|:..::..|....:.:.||.|.|.||.||:..|.
Human   525 G-NTYLY-AGHT-NQDHVHAVWKITSEAIGQLHRSLESCPGETVVAEDPAGLKVPLLLHQKQALA 586

  Fly   219 WMQFRERQKISGGILADDMGLGKTLSMIALILASEETKNR-KREEKKKALTLKWTQEFNRVYCKE 282
            |:.:||.||..||||||||||||||:||||||..   ||: |:|||:|:..|.|..:        
Human   587 WLLWRESQKPQGGILADDMGLGKTLTMIALILTQ---KNQEKKEEKEKSTALTWLSK-------- 640

  Fly   283 IRKISMFDDEEESGKEEEQYEPPEKRTCHVKTKKINQFRILDDDDNDAGDKAVVEDEQKDLLAKT 347
                                                      ||..|                  
Human   641 ------------------------------------------DDSCD------------------ 645

  Fly   348 PEPEVFSSDEEEEHLSNGRYPSANTLVVCPMSVMCQWAHEVASKVAQNAIRVLTFHGPNRHEIGI 412
                               :.|..||::||.|::..|.:||..:|..|.:||..:||||| :...
Human   646 -------------------FTSHGTLIICPASLIHHWKNEVEKRVNSNKLRVYLYHGPNR-DSRA 690

  Fly   413 EAFRSYDLVITSYNLVVNEL--------------------------------KRY---GNTSPLF 442
            ....:||:|||:|:||..|:                                .|:   |.::||.
Human   691 RVLSTYDIVITTYSLVAKEIPTNKQEAEIPGANLNVETLSIHYGSGAVSSRAARFPLQGTSTPLL 755

  Fly   443 AVYWNRVILDEAHIIRNSKTNCCNSVCQLRAHCHWALTGTPVQNRGVDVFALLRFVNVPNFQDLQ 507
            .:.|.|:||||||.::|.:.....:||:|:|...||:||||:||..:|:::||:|:....|.:..
Human   756 RIAWARIILDEAHNVKNPRVQTSIAVCKLQACARWAVTGTPIQNNLLDMYSLLKFLRCSPFDEFN 820

  Fly   508 QWKKNL-NESMLGHRRLNFIIKPLMLRRTKQKLQASG-DMPALPSLKIELICVQLSKTEMAVYQI 570
            .|:..: |.|..|..||:.:.|.|:|||||.:|.::| .:..||..|.:|..::||:.|..||.:
Human   821 LWRSQVDNGSKKGGERLSILTKSLLLRRTKDQLDSTGRPLVILPQRKFQLHHLKLSEDEETVYNV 885

  Fly   571 LSAISKKIFTQFLLQRE-----KGNSDLNYYSLERTPQFIAGHMSDE--RYNEIYERFLKSLGYN 628
            ..|.|:.....:|.:.|     .|.|..|.:|.      :|.....|  |::|..:....|.   
Human   886 FFARSRSALQSYLKRHESRGNQSGRSPNNPFSR------VALEFGSEEPRHSEAADSPRSST--- 941

  Fly   629 PGEKILGIYILVLLLRLRQFCCHPGLMIGMLRGALTAEDVQNVKVDASDVEGQLKMDVLAELDKF 693
                   ::||..||||||.|||    :.:|:.||...:::...:..| :|.||....|:||   
Human   942 -------VHILSQLLRLRQCCCH----LSLLKSALDPMELKGEGLVLS-LEEQLSALTLSEL--- 991

  Fly   694 DETDSEDDCCDEEDSTRRDGNFKLEVIKDEIKEENVPWDSGDDLPTASSFEDQLDSARALKLLNP 758
              .|||.......:.|    .||:|                                        
Human   992 --RDSEPSSTVSLNGT----FFKME---------------------------------------- 1010

  Fly   759 QNPIFQFIRPSAKLKMVIDKLEEL-LTGTNDKIIVTSQWVSYLAIVRKRLQ--DLSWETLDFNGQ 820
               :|:.:|.|.|:..::.:||.: ....:.|.::.|||.:.|.:|...|:  .|::.|:|  |.
Human  1011 ---LFEGMRESTKISSLLAELEAIQRNSASQKSVIVSQWTNMLKVVALHLKKHGLTYATID--GS 1070

  Fly   821 LTAKEREIVLRDFNANNEKRVLLLSLTAGGVGLNLNVANHMLIVDLHWNPQLERQAQDRIYRYGQ 885
            :..|:|..::..||.:...:|:|:||.||||||||...||:.::|:||||.||.||.|||||.||
Human  1071 VNPKQRMDLVEAFNHSRGPQVMLISLLAGGVGLNLTGGNHLFLLDMHWNPSLEDQACDRIYRVGQ 1135

  Fly   886 TKPTFIYRYMCQDTVEQRIKSLQDCKLEIAKVVLPEEGGEVTKCVGGGLNLAELKKLF 943
            .|...|:|::|:.|||::|..||:.|.::||.||...|..|||     |.||:|:.||
Human  1136 QKDVVIHRFVCEGTVEEKILQLQEKKKDLAKQVLSGSGESVTK-----LTLADLRVLF 1188

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10445NP_001246974.1 SNF2_N 212..655 CDD:278600 145/488 (30%)
DEXDc <372..483 CDD:238005 48/146 (33%)
HELICc 761..892 CDD:238034 53/134 (40%)
TTF2XP_016858039.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0141
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D132523at2759
OrthoFinder 1 1.000 FOG0003166
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45626
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2250
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
87.910

Return to query results.
Submit another query.