DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10445 and EDA16

Sequence 1:NP_001246974.1 Gene:CG10445 FlyBaseID:FBgn0037531 Length:945 Species:Drosophila melanogaster
Sequence 2:NP_176309.2 Gene:EDA16 AraportID:AT1G61140 Length:1280 Species:Arabidopsis thaliana

Alignment Length:1132 Identity:287/1133 (25%)
Similarity:433/1133 (38%) Gaps:364/1133 (32%)


  Fly     7 SDTTEIHKQSCSIQDQ------------------SSVP----VPDS---SGEINNW--------- 37
            ||....:..|||.||.                  ||||    |.|.   |||.|.|         
plant   314 SDLDRPNNYSCSFQDNKTVHVKVKPEAESEKVVYSSVPGEFSVRDDAYLSGETNRWWSGASSSAV 378

  Fly    38 ------------MEPEPV----DSLELSG----------EYADNESAIFVSASEYNEKKAQIDQL 76
                        |.|:..    ||.::|.          :|...:.:.....:||  |..||.|.
plant   379 SYQTDIEKGYSYMAPQTALPSQDSGKISSNHFYDSDTCLQYVVEDPSPVTQNNEY--KDFQIQQG 441

  Fly    77 VQKILTMEQQQRQLEENASETKELCDLKLHLEKLNARLEAL-GEFLDTLRLREDQQEIKIED--N 138
            .::.:    |.|.::...|               ||..|:: ....:.:...:|..::.|.:  .
plant   442 DREYI----QPRGIDSQFS---------------NASFESVQSHSSECISDSDDDSDVCIIEPYG 487

  Fly   139 SELVDH----TEQPKWSNLYSGLNRYRQKANHTAAQFYQHKSNII--DSLKTLYEP----IQPRP 193
            ...:.|    .:.|..|:.||.::....::.....|  .:|.|:|  .:|:.|.:|    |.|  
plant   488 QSAIPHRPLAMKMPVVSSEYSTVSHNFNQSGGLKLQ--SNKENMIFQAALQDLTQPNSEAILP-- 548

  Fly   194 AIDDLEKQPALLLVRLLKHQQSCLKWMQFRERQ--KISGGILADDMGLGKTLSMIALILASEETK 256
                    ..:|.|.||:||:..|.||..:|..  ..||||||||.|||||:|.|||||      
plant   549 --------DGVLTVPLLRHQRIALSWMAQKETSGFPCSGGILADDQGLGKTVSTIALIL------ 599

  Fly   257 NRKREEKKKALTLKWTQEFNRVYCKEIRKISMFDDEEESGKEEEQYEP--PEKRTCHVKTKKINQ 319
               :|..|.|..           |:|..|..:||.|.|:|    :..|  |..|:.|     ...
plant   600 ---KERSKPAQA-----------CEESTKKEIFDLESETG----ECAPLKPSGRSKH-----FEH 641

  Fly   320 FRILDDDDNDAGDKAVVEDEQKDLLAKTPEPEVFSSDEEEEHLSNGRYPSANTLVVCPMSVMCQW 384
            .::|.:::...||.          :.|.                .|| |:|.||||||.|||.||
plant   642 SQLLSNENKVGGDS----------VGKV----------------TGR-PAAGTLVVCPTSVMRQW 679

  Fly   385 AHEVASKVAQNA-IRVLTFHGPNR----HEIGIEAFRSYDLVITSYNLVVNEL------------ 432
            |.|:..||...| :.||.:||.:|    ||:.     .||:|:|::::|..|:            
plant   680 ADELHKKVTSEANLSVLVYHGSSRTKDPHELA-----KYDVVVTTFSIVSMEVPKQPLVDDEDEE 739

  Fly   433 --------------------------KRYGN--------TSPLFAVYWNRVILDEAHIIRNSKTN 463
                                      |:.|:        :.||..|.|.||:||||..|:|.||.
plant   740 KDGVHDGGTAATGFCSNKKRKYPPDSKKKGSKKKKVEFLSGPLAKVSWFRVVLDEAQSIKNYKTQ 804

  Fly   464 CCNSVCQLRAHCHWALTGTPVQNRGVDVFALLRFVNVPNFQDLQQWKKNLNESML-----GHRRL 523
            ...:...|||...|.|:|||:||...|:::..||:....:.....:...:...:.     |:::|
plant   805 VARACWGLRAKRRWCLSGTPIQNSIDDLYSYFRFLKYDPYSSYVLFCSTIKNPITRNPVKGYQKL 869

  Fly   524 NFIIKPLMLRRTKQKLQASGDMPALPSLKIELICVQLSKTEMAVYQILSAISKKIFTQFLLQREK 588
            ..|:|.:||||||..|.....:.:||...|||..|..:..|...|..|.|.|:   |||....|.
plant   870 QAILKTVMLRRTKGSLLDGKPIISLPPKSIELRKVDFTVEERDFYSKLEAESR---TQFREYAEA 931

  Fly   589 GNSDLNYYSLERTPQFIAGHMSDERYNEIYERFLKSLGYNPGEKILGIYILVLLLRLRQFCCHPG 653
            |....||                                        :.||::||||||.|.||.
plant   932 GTVKQNY----------------------------------------VNILLMLLRLRQACDHPL 956

  Fly   654 LM-----------IGMLRGALTA--------------EDVQ------------------------ 669
            |:           :|:.:..:.:              ||..                        
plant   957 LVNGEYSFTWESSVGLAKKQIQSDASLAICGICNDAPEDAVASVCGHVFCKQCIYERLTGDSNHC 1021

  Fly   670 -----NVKVDASDVEGQLKM-DVLAELDKFDETDSEDDCCDEEDSTRRDGNFK--LEVIKDEIKE 726
                 ||::..|.:..:.:: |.:.::.:...::|...|.| ||........|  ||:::     
plant  1022 PFANCNVRLTISSLSSKTRLDDAMPDMQERATSNSLSPCSD-EDLPYGSSKIKAALEILQ----- 1080

  Fly   727 ENVPWDSGDDLPTASSFED--QLDSARALKLLNPQNPIFQFIRPSAKLKMVIDKLEELLTGTNDK 789
                     .||.|....|  |:...|....|:        |.|.....|.:|...::   ..:|
plant  1081 ---------SLPKAHDLTDSNQISENREYSGLS--------ITPVKNEGMSVDVPIKV---AGEK 1125

  Fly   790 IIVTSQWVSYLAIVRKRL--QDLSWETLDFNGQLTAKEREIVLRDFNANNEKRVLLLSLTAGGVG 852
            .||.|||...|.::...|  ..:.:..||  |.::...|:..::|||...|..|:::||.|..:|
plant  1126 AIVFSQWTKMLNLLEASLVSSHIQYRRLD--GTMSVAARDKAVQDFNTLPEVTVMIMSLKAASLG 1188

  Fly   853 LNLNVANHMLIVDLHWNPQLERQAQDRIYRYGQTKPTFIYRYMCQDTVEQRIKSLQDCK-LEIAK 916
            ||:..|.|:|::||.|||..|.||.||.:|.|||:|..:.|:..:||||.||.:||..| :.:|.
plant  1189 LNMVAACHVLMLDLWWNPTTEDQAIDRAHRIGQTRPVTVVRFTVKDTVEDRILALQQKKRMMVAS 1253

  Fly   917 VVLPEEGGEVTKCVGGGLNLAELKKLF 943
            ....:|.|...    ..|.:.:|..||
plant  1254 AFGEDEKGSRQ----SHLTVEDLSYLF 1276

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10445NP_001246974.1 SNF2_N 212..655 CDD:278600 147/503 (29%)
DEXDc <372..483 CDD:238005 52/162 (32%)
HELICc 761..892 CDD:238034 45/133 (34%)
EDA16NP_176309.2 SNF2_N 559..958 CDD:278600 147/503 (29%)
zf-C3HC4_2 986..1023 CDD:290634 2/37 (5%)
Helicase_C 1124..1220 CDD:278689 37/98 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D132523at2759
OrthoInspector 1 1.000 T32131
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45626
Phylome 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.