DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10445 and AT1G50410

Sequence 1:NP_001246974.1 Gene:CG10445 FlyBaseID:FBgn0037531 Length:945 Species:Drosophila melanogaster
Sequence 2:NP_001323325.1 Gene:AT1G50410 AraportID:AT1G50410 Length:981 Species:Arabidopsis thaliana

Alignment Length:905 Identity:248/906 (27%)
Similarity:370/906 (41%) Gaps:276/906 (30%)


  Fly   185 LYEPIQPRPAIDDLEKQPA-LLLVRLLKHQQSCLKWMQFRERQKI--SGGILADDMGLGKTLSMI 246
            |.|..||:..:|    .|| ||.|.|:|||:..|.||..:|...:  .|||||||.|||||:|.|
plant   205 LQELNQPKSEVD----LPAGLLSVPLMKHQKIALAWMFQKETNSLHCMGGILADDQGLGKTVSTI 265

  Fly   247 ALIL-----ASEETKNRKREEKKKALTLKWTQEFNRVYCKEIRKISMFDDEEESGKEEEQYEPPE 306
            ||||     |..::||...:| .:||.|                    |.::||   |..:|.||
plant   266 ALILKQMHEAKLKSKNSGNQE-AEALDL--------------------DADDES---ENAFEKPE 306

  Fly   307 KRTCHVKTKKINQFRILDDDDNDAGDKAVVEDEQKDLLAKTPEPEVFSSDEEEEHLSNGRYPSAN 371
                   :|..|...:    :.|:|.|....:|......|                .|.:.|:|.
plant   307 -------SKASNGSGV----NGDSGIKKAKGEEASTSTRK----------------FNRKRPAAG 344

  Fly   372 TLVVCPMSVMCQWAHEVASKVAQNA-IRVLTFHGPNRHEIGIEAFRSYDLVITSYNLVVNEL--- 432
            ||:|||.||:.|||.|:..||...| :.||.:||.||.:..|| ...||:|:|:|.:|.||:   
plant   345 TLIVCPASVVRQWARELDEKVTDEAKLSVLIYHGGNRTKDPIE-LAKYDVVMTTYAIVSNEVPKQ 408

  Fly   433 -------------KRYG------------------------------------NTSPLFAVYWNR 448
                         ::||                                    ::..|..|.|.|
plant   409 PLVDDDENDEKNSEKYGLASGFSINKKRKNVVGTTKKSKKKKGNNNAGDSSDPDSGTLAKVGWFR 473

  Fly   449 VILDEAHIIRNSKTNCCNSVCQLRAHCHWALTGTPVQNRGVDVFALLRFVNVPNFQDLQQWKKNL 513
            |:||||..|:|.:|....:.|.|||...|.|:|||:||...|:::..||:....:...:.:...:
plant   474 VVLDEAQTIKNHRTQVARACCGLRAKRRWCLSGTPIQNTIDDLYSYFRFLKYDPYAVYKSFCHQI 538

  Fly   514 -----NESMLGHRRLNFIIKPLMLRRTKQKLQASGDMPALPSLKIELICVQLSKTEMAVYQILSA 573
                 ..|:.|:::|..:::.:||||||..|.....:..||...|.|..|..|..|.:.|..|.:
plant   539 KGPISRNSLQGYKKLQAVLRAIMLRRTKGTLLDGQPIINLPPKTINLSQVDFSVEERSFYVKLES 603

  Fly   574 ISKKIFTQFLLQREKGNSDLNYYSLERTPQFIAGHMSDERYNEIYERFLKSLGYNPGEKILGIYI 638
            .|:   :||......|..:.||.:                                        |
plant   604 DSR---SQFKAYAAAGTLNQNYAN----------------------------------------I 625

  Fly   639 LVLLLRLRQFCCHPGLMIGMLRGALTAEDVQNVKVDASDVEGQLKMDVLAELDKFD------ETD 697
            |::||||||.|.||                |.||...||..|::..:.:.:|.|.|      ..:
plant   626 LLMLLRLRQACDHP----------------QLVKRYNSDSVGKVSEEAVKKLPKEDLVSLLSRLE 674

  Fly   698 SEDDCC-----DEEDSTRRDGN-FKLEVIKDEI--KEENVPWDS--------------------G 734
            |...||     .|:......|: |..:.:.|.|  .|:..|...                    .
plant   675 SSPICCVCHDPPEDPVVTLCGHIFCYQCVSDYITGDEDTCPAPRCREQLAHDVVFSKSTLRSCVA 739

  Fly   735 DDLPTASSFEDQLDSARALKLLNPQNPIFQFIRPSAKLKMVIDKLEELLT-GT------------ 786
            |||..:||.::..|.:..      ||..|.    |:|:|.|:|.|:.|.. ||            
plant   740 DDLGCSSSEDNSHDKSVF------QNGEFS----SSKIKAVLDILQSLSNQGTSNSTQNGQMASS 794

  Fly   787 ----ND---------------------------KIIVTSQWVSYLAIVRKRLQDLSWETLDFNGQ 820
                ||                           |.|:.|||...|.:|...|.:.|.|....:|.
plant   795 SQQPNDDDDDDDDDVTIVEKTSLKSTPSNGGPIKTIIFSQWTGMLDLVELSLIENSIEFRRLDGT 859

  Fly   821 LTAKEREIVLRDFNANNEKRVLLLSLTAGGVGLNLNVANHMLIVDLHWNPQLERQAQDRIYRYGQ 885
            ::...|:..:::|:.:.:.:|:::||.||.:|||:..|.|::::||.|||..|.||.||.:|.||
plant   860 MSLIARDRAVKEFSNDPDVKVMIMSLKAGNLGLNMIAACHVILLDLWWNPTTEDQAIDRAHRIGQ 924

  Fly   886 TKPTFIYRYMCQDTVEQRIKSLQDCKLEIAKVVLPEE--GGEVTKCVGGGLNLAELKKLF 943
            |:|..:.|...::|||.||.:||:.|.::......|:  |...|:     |.:.:||.||
plant   925 TRPVTVTRITIKNTVEDRILALQEEKRKMVASAFGEDHGGSSATR-----LTVDDLKYLF 979

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10445NP_001246974.1 SNF2_N 212..655 CDD:278600 142/508 (28%)
DEXDc <372..483 CDD:238005 52/164 (32%)
HELICc 761..892 CDD:238034 50/175 (29%)
AT1G50410NP_001323325.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D132523at2759
OrthoInspector 1 1.000 T32131
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45626
Phylome 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.