DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10445 and AT1G02670

Sequence 1:NP_001246974.1 Gene:CG10445 FlyBaseID:FBgn0037531 Length:945 Species:Drosophila melanogaster
Sequence 2:NP_001321902.1 Gene:AT1G02670 AraportID:AT1G02670 Length:690 Species:Arabidopsis thaliana

Alignment Length:790 Identity:197/791 (25%)
Similarity:317/791 (40%) Gaps:250/791 (32%)


  Fly   195 IDDLEKQPALLLVRLLKHQQSCLKWMQFRERQKISGGILADDMGLGKTLSMIALILASEETKNRK 259
            |.:..:||..|::.|||:|:..|.|...:|...:.||||||:||:|||:..|:|:||..|....|
plant   109 IAEAAEQPLDLIIPLLKYQKEFLAWATIQELSAVRGGILADEMGMGKTIQAISLVLARREVDRAK 173

  Fly   260 REEKKKALTLKWTQEFNRVYCKEIRKISMFDDEEESGKEEEQYEPPEKRTCHVKTKKINQFRILD 324
            ..|                                                              
plant   174 SRE-------------------------------------------------------------- 176

  Fly   325 DDDNDAGDKAVVEDEQKDLLAKTPEPEVFSSDEEEEHLSNGRYPSANTLVVCPMSVMCQWAHEVA 389
                     ||                                  .:|||:.|...:.||..|::
plant   177 ---------AV----------------------------------GHTLVLVPPVALSQWLDEIS 198

  Fly   390 SKVAQNAIRVLTFHGPNRHEIGIEAFRSYDLVITSYNLVVNELKRYGNT----SPLFAVYWNRVI 450
            ...:..:.|||.:|||.|.: .::...:||.|:|:..:|.||.::....    |||.::.|||:|
plant   199 RLTSPGSTRVLQYHGPKRDK-NVQKLMNYDFVLTTSPIVENEYRKDEGVDETMSPLHSIKWNRII 262

  Fly   451 LDEAHIIRNSKTNCCNSVCQLRAHCHWALTGTPVQNRGVDVFALLRFVNVPNF------------ 503
            :||||.|:|..:....:|..|.|...|||:|||:||...::::|:||:.|..:            
plant   263 VDEAHDIKNRSSRTAKAVFALEATYRWALSGTPLQNDVDELYSLIRFLRVSPYSYYFCKKCDCEV 327

  Fly   504 -----------------QDLQQWKKNLNESMLGHRRLNF----IIKPLMLRRTKQKLQASGDMPA 547
                             |.:..||:|:::..  :|...|    ::|.::||||  ||..:.|: |
plant   328 LDRSAHRKCPSCPHNANQHISWWKENVDKRR--NRACIFLKQNVLKDILLRRT--KLGRAADL-A 387

  Fly   548 LPSLKIELICVQLSKTEMAVYQILSAISKKIFTQFLLQREKGNSDLNYYSLERTPQFIAGHMSDE 612
            |||..|.|....||..|...|:.|..:||..|..::    :..:.:|.|:               
plant   388 LPSRIISLRRDALSVVEADFYESLYKVSKTTFDGYI----QAGTLMNNYA--------------- 433

  Fly   613 RYNEIYERFLKSLGYNPGEKILGIYILVLLLRLRQFCCHPGLMIGMLRGALTAEDVQNVKVDASD 677
                                    :|..||:||||...||.|                  |..|.
plant   434 ------------------------HIFGLLIRLRQAVDHPYL------------------VSYSS 456

  Fly   678 VEGQLKMDVLAELDKFDETDSEDDCCDEEDSTRRDGNFKLEVIKDEIKEENVPWDSGDDLPTASS 742
            ..|       |..:..|...:|.:|....|.::                        |...|:|.
plant   457 PSG-------ANANLLDANKNEKECGFGHDPSK------------------------DYFVTSSE 490

  Fly   743 FE---DQLDSARALKLLNPQNPIFQFIRPSAKLKMVIDKLEELL-TGTNDKIIVTSQWVSYLAIV 803
            .:   .:|...||..:||..|  ....:.|.|::.:.:::..:: ...:.|.||.||:.|:|.::
plant   491 HQASKTKLKGFRASSILNRIN--LDDFKTSTKIEALREEIRFMVERDWSAKAIVFSQFTSFLDLI 553

  Fly   804 RKRLQDLSWETLDFNGQLTAKEREIVLRDFNANNEKRVLLLSLTAGGVGLNLNVANHMLIVDLHW 868
            ...|.......:...|.::...::..|::|....:.||||:||.||||.|||..|:|:.::|..|
plant   554 SYALGKSGVSCVQLVGSMSKAAKDAALKNFKEEPDCRVLLMSLQAGGVALNLTAASHVFMMDPWW 618

  Fly   869 NPQLERQAQDRIYRYGQTKPTFIYRYMCQDTVEQRIKSLQDCKLEIAKVVLPEEGGEVTKCVGGG 933
            ||.:||||||||:|.||.||..:.|::.:.|||::|.:||..|.::.:..|    |:..:.|...
plant   619 NPAVERQAQDRIHRIGQCKPVRVVRFIMEKTVEEKILTLQKKKEDLFESTL----GDSEEAVVQK 679

  Fly   934 LNLAELKKLF 943
            |...::|.||
plant   680 LGEDDIKSLF 689

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10445NP_001246974.1 SNF2_N 212..655 CDD:278600 113/480 (24%)
DEXDc <372..483 CDD:238005 42/115 (37%)
HELICc 761..892 CDD:238034 45/132 (34%)
AT1G02670NP_001321902.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 275 1.000 Inparanoid score I875
OMA 1 1.010
OrthoDB 1 1.010 D132523at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
33.070

Return to query results.
Submit another query.