DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10445 and AT1G05120

Sequence 1:NP_001246974.1 Gene:CG10445 FlyBaseID:FBgn0037531 Length:945 Species:Drosophila melanogaster
Sequence 2:NP_001323244.1 Gene:AT1G05120 AraportID:AT1G05120 Length:876 Species:Arabidopsis thaliana

Alignment Length:1036 Identity:232/1037 (22%)
Similarity:367/1037 (35%) Gaps:397/1037 (38%)


  Fly    35 NNWMEP--EPVDSLELSGEYADNESAIFVSASEYNEKKAQIDQLVQKILTMEQQQRQLEENASET 97
            |..:.|  |.||..|.:|...|.|.....|..:....:.|.|         |:::.:|||..:..
plant    50 NKAIRPSTEVVDLEEGTGINPDEEPYAISSDDDSIGSEFQGD---------EEEEEELEEVVAND 105

  Fly    98 KELCDLK--------LHLEKLNARLEALGEFLDTLRLREDQQEIKIEDNSELVDHT---EQPKWS 151
                ||.        ::|.:.:.:           |.:.|.::.|:    .|:..|   ||..|.
plant   106 ----DLPNPVPVLAIVNLPRASKK-----------RKKPDARKEKV----VLLWETWEKEQNSWI 151

  Fly   152 NLYSGLNRYRQKANHTAAQFYQHKSNIIDSLKTLYEPIQPRPAIDDLEKQPALLLVRLLKHQQSC 216
            :                    :|.|..:|.       .|....|.:..:.|:.|::.||::|:..
plant   152 D--------------------EHMSEDVDL-------DQHNAVIAETAEPPSDLIMPLLRYQKEF 189

  Fly   217 LKWMQFRERQKISGGILADDMGLGKTLSMIALILASEETKNRKREEKKKALTLKWTQEFNRVYCK 281
            |.|.. ::.|.::||||||:||:|||:..|:|:||..|.                          
plant   190 LAWAT-KQEQSVAGGILADEMGMGKTIQAISLVLARREV-------------------------- 227

  Fly   282 EIRKISMFDDEEESGKEEEQYEPPEKRTCHVKTKKINQFRILDDDDNDAGDKAVVEDEQKDLLAK 346
                     |..:.|         |...|                                    
plant   228 ---------DRAQFG---------EAAGC------------------------------------ 238

  Fly   347 TPEPEVFSSDEEEEHLSNGRYPSANTLVVCPMSVMCQWAHEVASKVAQNAIRVLTFHGPNRHEIG 411
                                     |||:||:..:.||.:|:|...:..:.:||.:||..|.: .
plant   239 -------------------------TLVLCPLVAVSQWLNEIARFTSPGSTKVLVYHGAKRAK-N 277

  Fly   412 IEAFRSYDLVITSYNLVVNELKRYGNTSP------------------------------------ 440
            |:.|.:||.|:|:|:.|.:|.:|  |..|                                    
plant   278 IKEFMNYDFVLTTYSTVESEYRR--NIMPSKVQCAYCSKSFYPKKLVIHLRYFCGPSAVKTAKQS 340

  Fly   441 ---------------------------------------------------LFAVYWNRVILDEA 454
                                                               |.:|.|||:|||||
plant   341 KQKRKKTSDSSSQQGKEADAGEDKKLKKSKKKTKQTVEKDQLGSDDKEKSLLHSVKWNRIILDEA 405

  Fly   455 HIIRNSKTNCCNSVCQLRAHCHWALTGTPVQNRGVDVFALLRFVNVPNF---------------- 503
            |.|:..::|...:|..|.|...|||:|||:|||..::::|:||:.:..:                
plant   406 HYIKERRSNTARAVFALEATYRWALSGTPLQNRVGELYSLIRFLQIRPYSYYFCKDCDCRILDYV 470

  Fly   504 -------------QDLQQWKKNLNESM-------LGHRRL----NFIIKPLMLRRTKQKLQASGD 544
                         :....|.|.:.:.:       ||.|.:    :.::|.::||||  ||..:.|
plant   471 AHQSCPHCPHNAVRHFCWWNKYVAKPITVYGSFGLGKRAMILLKHKVLKDILLRRT--KLGRAAD 533

  Fly   545 MPALPSLKIELICVQLSKTEMAVYQILSAISKKIFTQFLLQREKGNSDLNYYSLERTPQFIAGHM 609
            : |||...|.|....|...|...|:.|...|:..|..::   |.|....||           .|:
plant   534 L-ALPPRIITLRRDTLDVKEFDYYESLYKNSQAEFNTYI---EAGTLMNNY-----------AHI 583

  Fly   610 SDERYNEIYERFLKSLGYNPGEKILGIYILVLLLRLRQFCCHPGLMIGMLRGALTAEDVQNVKVD 674
            .|                             ||.||||...||.|::                  
plant   584 FD-----------------------------LLTRLRQAVDHPYLVV------------------ 601

  Fly   675 ASDVEGQLKMDVLAELDKFDETDSEDDC--CDE--EDSTRRDG----------NFKLEVIKDEI- 724
            .|:..|       |..:..||..||.:|  |.:  ||......          .|...:.|... 
plant   602 YSNSSG-------ANANLVDENKSEQECGLCHDPAEDYVVTSCAHVFCKACLIGFSASLGKVTCP 659

  Fly   725 ---KEENVPWDSGDDLPTASSFEDQLDSARALKLLNPQNPIFQFIRPSAKLKMVIDKLEELLTGT 786
               |...|.|.:..|....:| :..|...||..:|| :..:..| :.|.|::.:.:::..::...
plant   660 TCSKLLTVDWTTKADTEHKAS-KTTLKGFRASSILN-RIKLDDF-QTSTKIEALREEIRFMVERD 721

  Fly   787 ND-KIIVTSQWVSYLAIVRKRLQDLSWETLDFNGQLTAKEREIVLRDFNANNEKRVLLLSLTAGG 850
            .. |.||.||:.|:|.::...|.......:...|.:|...|:..:..|..:.:.||.|:||.|||
plant   722 GSAKAIVFSQFTSFLDLINYTLGKCGVSCVQLVGSMTMAARDTAINKFKEDPDCRVFLMSLKAGG 786

  Fly   851 VGLNLNVANHMLIVDLHWNPQLERQAQDRIYRYGQTKPTFIYRYMCQDTVEQRIKSLQDCK 911
            |.|||.||:|:.::|..|||.:||||||||:|.||.||..:.|::.::|||:||..||..|
plant   787 VALNLTVASHVFMMDPWWNPAVERQAQDRIHRIGQYKPIRVVRFIIENTVEERILRLQKKK 847

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10445NP_001246974.1 SNF2_N 212..655 CDD:278600 117/570 (21%)
DEXDc <372..483 CDD:238005 47/198 (24%)
HELICc 761..892 CDD:238034 47/132 (36%)
AT1G05120NP_001323244.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 275 1.000 Inparanoid score I875
OMA 1 1.010
OrthoDB 1 1.010 D132523at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
33.070

Return to query results.
Submit another query.