DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10445 and AT1G11100

Sequence 1:NP_001246974.1 Gene:CG10445 FlyBaseID:FBgn0037531 Length:945 Species:Drosophila melanogaster
Sequence 2:NP_001320184.1 Gene:AT1G11100 AraportID:AT1G11100 Length:1270 Species:Arabidopsis thaliana

Alignment Length:1095 Identity:278/1096 (25%)
Similarity:411/1096 (38%) Gaps:358/1096 (33%)


  Fly    10 TEIHKQSCSIQDQSSVPVPDSSGE-----------INNWMEPEPVDSLELSGEYADNESAIFVSA 63
            |::.|:...|..|::.|..|..|.           ..|..:|:|        |.:..||      
plant   371 TDVGKEYPFIPPQTAFPGQDIDGRSFYSCFDSDDCFQNVTDPDP--------ETSRTES------ 421

  Fly    64 SEYNEKKAQIDQLVQKILTMEQQQRQLEENASETKELCDLKLHLEKLNARLEALGEFLDTLRL-- 126
                     :|.||.            :|:....|..|      ..|::......|.|.:.|:  
plant   422 ---------LDYLVG------------DEDHEYIKRTC------FNLSSFSSGTVESLSSKRIPE 459

  Fly   127 REDQQEI-KIEDNSELVD-H----TEQPKWSNLYS----------GLNRYRQKAN---HTAAQ-F 171
            |||..|| |||...|.|: |    .::|.:|:.:|          ||.....|.|   |...| .
plant   460 REDDSEIHKIESYGEFVNPHQYLPVQRPVFSSEHSTGSQTLNNCGGLKFESNKGNMNFHADLQDL 524

  Fly   172 YQHKSNIIDSLKTLYEPIQPRPAIDDLEKQP--ALLLVRLLKHQQSCLKWMQFRER--QKISGGI 232
            .||.|                      |..|  .:|.|.||:||:..|.||..:|.  ....|||
plant   525 SQHSS----------------------EASPPDGVLAVSLLRHQRIALSWMSQKETSGNPCFGGI 567

  Fly   233 LADDMGLGKTLSMIALILASEETKNRKREEKKKALTLKWTQEFNRVYCKEIRKISMFDDEEESGK 297
            ||||.|||||:|.|||||....|.....||                            |.:..| 
plant   568 LADDQGLGKTVSTIALILTERSTPYLPCEE----------------------------DSKNGG- 603

  Fly   298 EEEQYEPPEKRTCHVKTKKINQFRILDDDDNDAGDKAVVEDEQK---DLLAKTPEPEVFSSDEEE 359
                        |                 |.:....||.:|.|   |.|.|             
plant   604 ------------C-----------------NQSDHSQVVFNENKVVEDSLCK------------- 626

  Fly   360 EHLSNGRYPSANTLVVCPMSVMCQWAHEVASKVAQNA-IRVLTFHGPNR----HEIGIEAFRSYD 419
               ..|| |:|.||:|||.|:|.|||.|:..||...| :.||.:||.:|    ||:.     .||
plant   627 ---MRGR-PAAGTLIVCPTSLMRQWADELRKKVTLEAHLSVLVYHGCSRTKDPHELA-----KYD 682

  Fly   420 LVITSYNLVVNELKR----------------------YGN------------------------- 437
            :|||:|:||..|:.:                      :|:                         
plant   683 VVITTYSLVSVEVPKQPRDRADEEKGGIHDGGVESVGFGSNKKDLPNSQKKGTKKRKHMDCEPVE 747

  Fly   438 --TSPLFAVYWNRVILDEAHIIRNSKTNCCNSVCQLRAHCHWALTGTPVQNRGVDVFALLRFVNV 500
              :.||..|.|.||:||||..|:|.||....:...|.|...|.|:|||:||...|:::..||:..
plant   748 FLSGPLAQVSWFRVVLDEAQSIKNYKTQASIACSGLHAKRRWCLSGTPIQNSIADLYSYFRFLKY 812

  Fly   501 PNFQDLQQWKKNLNESML-----GHRRLNFIIKPLMLRRTKQKLQASGDMPALPSLKIELICVQL 560
            ..:...|.:.:.:...:.     |::.|..|:|.:||||||..|.....:.:||...|||..|..
plant   813 DPYSSYQTFCETIKNPISSYPGEGYKTLQAILKKVMLRRTKDTLLDGKPVISLPPKSIELRRVDF 877

  Fly   561 SKTEMAVYQILSAISKKIFTQFLLQREKGNSDLNYYSLERTPQFIAGHMSDERYNEIYERFLKSL 625
            :|.|...|..|...|:..|.::   .|.|....||                              
plant   878 TKEERDFYSKLECDSRDQFKEY---AEAGTVKQNY------------------------------ 909

  Fly   626 GYNPGEKILGIYILVLLLRLRQFCCHPGLMIGMLRGALTAEDVQNVKVD-----ASDVEGQLKMD 685
                      :.||::||||||.|.|| |::..|..:.:||.|:.:..:     ...:|..|.:.
plant   910 ----------VNILLMLLRLRQACGHP-LLVSSLSWSSSAEMVKKLPYEKLTFLLHRLEASLAIC 963

  Fly   686 VLAELDKFDETDSE------DDCCDEEDSTRRDGN----------------FKLEVIKD---EIK 725
            .:..:...|...|.      :.|..|  ...||.|                |..|.:::   ::.
plant   964 GICNVAPKDAVVSLCGHVFCNQCICE--CLTRDNNQCPLSYCKVGLEISSLFSRETLENAMLDLH 1026

  Fly   726 EENVPWD--------SG---DDLPTASS-FEDQLDSARALKLLNPQNPIF--------------- 763
            :.:.|.|        ||   ::||..|| .:..||..::|.  .||:|..               
plant  1027 KLDAPCDRTTSDPVGSGEPCENLPCGSSKIKAALDILQSLS--RPQSPATVMNDVNQSSENGENN 1089

  Fly   764 -----QFIRPSAKLKMVIDKLEELLTGTNDKIIVTSQWVSYLAIVRKRLQDLSWETLDFNGQLTA 823
                 .|..|:...|..:..:..:   ..:|.||.:||...|.::...|:....:...|:|::|.
plant  1090 QQLDKSFSLPATPAKSSVGGVVNV---AGEKAIVFTQWTKMLDLLEAGLKSSGIQYRRFDGKMTV 1151

  Fly   824 KEREIVLRDFNANNEKRVLLLSLTAGGVGLNLNVANHMLIVDLHWNPQLERQAQDRIYRYGQTKP 888
            ..|:..::|||...:..|:::||.|..:|||:..|.|::::||.|||..|.||.||.:|.|||:|
plant  1152 PARDAAVQDFNTLPDVSVMIMSLKAASLGLNMVAACHVIMLDLWWNPTTEDQAIDRAHRIGQTRP 1216

  Fly   889 TFIYRYMCQDTVEQRIKSLQDCKLEIAKVVLPEEGGEVTKCVGGGLNLAELKKLF 943
            ..:.|:..:||||.||.:||..|   .|:|....|..........|::.:|..||
plant  1217 VKVVRFTVKDTVEDRILALQQKK---RKMVASAFGEHENGSRESHLSVEDLNYLF 1268

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10445NP_001246974.1 SNF2_N 212..655 CDD:278600 139/507 (27%)
DEXDc <372..483 CDD:238005 51/165 (31%)
HELICc 761..892 CDD:238034 42/151 (28%)
AT1G11100NP_001320184.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D132523at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45626
Phylome 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.