DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10445 and AT5G43530

Sequence 1:NP_001246974.1 Gene:CG10445 FlyBaseID:FBgn0037531 Length:945 Species:Drosophila melanogaster
Sequence 2:NP_199166.1 Gene:AT5G43530 AraportID:AT5G43530 Length:1277 Species:Arabidopsis thaliana

Alignment Length:1164 Identity:270/1165 (23%)
Similarity:438/1165 (38%) Gaps:391/1165 (34%)


  Fly     3 SSSPSDTTEIHKQSCSIQDQSSV--------PVP---------------DSSGEIN-NWMEPEPV 43
            ||..||.|...::...::..:.|        |.|               |...|.: ..::.|||
plant   281 SSGDSDGTSAKRRKMEMESYAPVGVESCILAPTPLRVVKPEKLDTPEVIDLESEKSYTHVKMEPV 345

  Fly    44 DSLELSG----------EYADNESAIFVSASEYNEKKAQIDQ----------LVQKIL---TMEQ 85
            :.:::..          :::..:.:::|.......:|.:::.          ||.:.|   |...
plant   346 EEIKVEAVKMSSQVEDVKFSREQKSVYVKKEPVGARKVKVEDGDFPVEKDWYLVGRSLVTATSTS 410

  Fly    86 QQRQLEEN-------------------ASETKELCDL-KLHLE--------------KLNARLEA 116
            :.|:||:|                   ...||...:: :|.:|              |:..|..|
plant   411 KGRKLEDNEIVNFTFSSVAKWKVPNIVRFSTKRCGEIGRLPMEWSNWAVSLLRSGKVKMLGRCVA 475

  Fly   117 LGEFLDTLRLREDQQEIKIEDNSELVDHTEQPKW-----SNLYSGLNRYRQKANHTAAQFYQHKS 176
            ...||  ..::|....:....:|.:.....:..|     .||.|.|:...|...|...:.||...
plant   476 APPFL--TMMQEIMLYVSFYIHSSIFTDVSKSTWRIGSSPNLESTLHPLLQLFKHLTIKPYQKAE 538

  Fly   177 NIIDSLKT------LYEPIQPRPAIDDLEKQ---------------------------------- 201
            ...:.|.:      |.:....|.|:..:.|:                                  
plant   539 FTPEELNSRKRSLNLEDDYDERAALLAIAKRRKGCQQSLEQNKDEEEAPESYMNRVVGAADSYNL 603

  Fly   202 -----PALLLVRLLKHQQSCLKWMQFRER------------------------------------ 225
                 |:.|...|..:|:..|.||...|:                                    
plant   604 EEMEAPSTLTCNLRPYQKQALYWMSESEKGIDVEKAAETLHPCWEAYRICDERAPSIYLNIFSGE 668

  Fly   226 ---------QKISGGILADDMGLGKTLSMIALILASEETKNRKREEKKKALTLKWTQEFNRVYCK 281
                     |...||||||.||||||:..||||||.....|.:.|:                   
plant   669 ATIQFPTATQMARGGILADAMGLGKTVMTIALILARPGRGNPENED------------------- 714

  Fly   282 EIRKISMFDDEEESGKEEEQYEPPEKRTCHVKTKKINQFRILDDDDNDAGDKAVVEDEQKDLLAK 346
                                                                .:|.|...|    
plant   715 ----------------------------------------------------VLVADVNAD---- 723

  Fly   347 TPEPEVFSSDEEEEHLSNGRYPS-ANTLVVCPMSVMCQWAHEVASKVAQNAIRVLTFHGPNR-HE 409
                   ..:.:|.|::.....: ..||::|||:::.||..|:.:....:.:.||.::|.:| |:
plant   724 -------KRNRKEIHMALTTVKAKGGTLIICPMALLSQWKDELETHSKPDTVSVLVYYGGDRTHD 781

  Fly   410 IGIEAFRSYDLVITSYNLVVNELKRYGNTSPLFAVYWNRVILDEAHIIRNSKTNCCNSVCQLRAH 474
              .:|..|:|:|:|:|.::.:..|:....|....:.|.|::|||||.|::.||....:..:|.:|
plant   782 --AKAIASHDVVLTTYGVLTSAYKQDMANSIFHRIDWYRIVLDEAHTIKSWKTQAAKATFELSSH 844

  Fly   475 CHWALTGTPVQNRGVDVFALLRFVNVPNFQDLQQWKKNL-----NESMLGHRRLNFIIKPLMLRR 534
            |.|.|||||:||:..|:::||.|::|..:.:...|.|.:     |....|.:.:..|::||||||
plant   845 CRWCLTGTPLQNKLEDLYSLLCFLHVEPWCNWAWWSKLIQKPYENGDPRGLKLIKAILRPLMLRR 909

  Fly   535 TKQKLQASGDM-PALPSLKIELICVQLSKTEMAVYQILSAISKKIFTQFLLQREKGNSDLNYYSL 598
            ||:.....|.: ..||...:::|..:.|:.|...|..|...||..|.||:.|             
plant   910 TKETRDKEGSLILELPPTDVQVIECEQSEAERDFYTALFKRSKVQFDQFVAQ------------- 961

  Fly   599 ERTPQFIAGHMSDERYNEIYERFLKSLGYNPGEKILGIY--ILVLLLRLRQFCCHPGLMIGMLRG 661
                                            .|:|..|  ||.|||||||.|.||.|:      
plant   962 --------------------------------GKVLHNYANILELLLRLRQCCNHPFLV------ 988

  Fly   662 ALTAEDVQNVKVDASDVEGQLKMDVLAELDKFDETDSEDDCCDEEDSTR----------RDGNFK 716
                       :..:|.:....:|.||.  :|  .|:..|...:...:|          ||||  
plant   989 -----------MSRADSQQYADLDSLAR--RF--LDNNPDSVSQNAPSRAYIEEVIQDLRDGN-- 1036

  Fly   717 LEVIKDEIKEENVPWDSGDD---LPTASSF--EDQLDSARA---------------LKLLN-PQN 760
                   .||..:..:|.||   .|.|...  |..|.|.|:               .:|:: |.:
plant  1037 -------SKECPICLESADDPVLTPCAHRMCRECLLTSWRSPSCGLCPICRTILKRTELISCPTD 1094

  Fly   761 PIFQF-----IRPSAKLKMVIDKLEEL-LTGTNDKIIVTSQWVSYLAIVRKRLQDLSWETLDFNG 819
            .||:.     .:.|:|:..::..||:: .:|:.:|.||.|||.|:|.::...|:...:|.|.|:|
plant  1095 SIFRVDVVKNWKESSKVSELLKCLEKIKKSGSGEKSIVFSQWTSFLDLLEIPLRRRGFEFLRFDG 1159

  Fly   820 QLTAKEREIVLRDFNANNEKRVLLLSLTAGGVGLNLNVANHMLIVDLHWNPQLERQAQDRIYRYG 884
            :|..|.||.||::||...:|.:||:||.||||||||..|:.:.::|..|||.:|.||..||:|.|
plant  1160 KLAQKGREKVLKEFNETKQKTILLMSLKAGGVGLNLTAASSVFLMDPWWNPAVEEQAIMRIHRIG 1224

  Fly   885 QTKPTFIYRYMCQDTVEQRIKSLQDCKLEIAKVVLPEEGGEVTKCVGGGLNLAELKKLF 943
            |.:..|:.|::.:||||:|::.:|..|..:....|.:|  ||...     .|.|||.||
plant  1225 QKRTVFVRRFIVKDTVEERMQQVQARKQRMIAGALTDE--EVRSA-----RLEELKMLF 1276

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10445NP_001246974.1 SNF2_N 212..655 CDD:278600 121/498 (24%)
DEXDc <372..483 CDD:238005 39/112 (35%)
HELICc 761..892 CDD:238034 55/137 (40%)
AT5G43530NP_199166.1 HIRAN 402..490 CDD:214906 16/90 (18%)
SNF2_N 680..988 CDD:278600 115/437 (26%)
DEXDc 681..853 CDD:238005 64/256 (25%)
RING 1039..1083 CDD:238093 10/44 (23%)
Helicase_C 1112..1224 CDD:278689 48/112 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D132523at2759
OrthoInspector 1 1.000 T32131
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.