DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10445 and AT3G20010

Sequence 1:NP_001246974.1 Gene:CG10445 FlyBaseID:FBgn0037531 Length:945 Species:Drosophila melanogaster
Sequence 2:NP_001319598.1 Gene:AT3G20010 AraportID:AT3G20010 Length:1047 Species:Arabidopsis thaliana

Alignment Length:907 Identity:236/908 (26%)
Similarity:366/908 (40%) Gaps:264/908 (29%)


  Fly   181 SLKTLYEPIQPRPAIDDLEKQPALLLVRLLKHQQSCLKWMQFRERQKIS--GGILADDMGLGKTL 243
            :|:.|.:|      :.:.:..|..|.|.|::||:..|.||..:|....:  |||||||.|||||:
plant   259 ALQVLNQP------MTESDLPPGTLSVPLMRHQKIALAWMFQKETSSFNCPGGILADDQGLGKTV 317

  Fly   244 SMIALILASEETKNRKREEKKKALTLKWTQEFNRVYCKEIRKISMF--DDEEESGKEEE-QYEPP 305
            |.|||||..:.....|.|..                ||:..:..:.  |||.::.|.|. .:..|
plant   318 STIALILKQKIVSQLKSESS----------------CKQETEALVLDADDESDNAKHESGSHVKP 366

  Fly   306 EKRTCHVKTKKINQFRILD---DDDNDAGDKAVVEDEQKDLLAKTPEPEVFSSDEEEEHLSNGRY 367
            |     :|....::..:|.   :|:||:.|....|||:.:               ........:.
plant   367 E-----LKVSSNSETSVLSACGNDENDSSDMEKAEDEEAN---------------SSTRAFQWKR 411

  Fly   368 PSANTLVVCPMSVMCQWAHEVASKVAQNA-IRVLTFHGPNRHEIGIEAFRSYDLVITSYNLVVNE 431
            |:|.||:|||.||:.|||.|:..||::.: :.||.:||.||.:...| ...||:|:|:|.:|.||
plant   412 PAAGTLIVCPASVVRQWARELDEKVSEESKLSVLVYHGSNRTKDPNE-LAEYDVVVTTYAIVTNE 475

  Fly   432 ----------------LKRYGNTS------------------------------------PLFAV 444
                            ..|||..|                                    ||..|
plant   476 APNKFLVDEDENDEKNTDRYGLASGFSNNKKRKVVVGASKKSKRRGRKSTNDTSSEPDCGPLGKV 540

  Fly   445 YWNRVILDEAHIIRNSKTNCCNSVCQLRAHCHWALTGTPVQNRGVDVFALLRFVNVPNFQDLQQW 509
            .|.|::||||..|:|.:|....|.|.|||...|.|:|||:||...|:::..||:....:...:.:
plant   541 GWFRIVLDEAQTIKNYRTQMARSCCTLRAKRRWCLSGTPIQNTIDDLYSYFRFLRYDPYAVYKSF 605

  Fly   510 KKNL-----NESMLGHRRLNFIIKPLMLRRTKQKLQASGDMPALPSLKIELICVQLSKTEMAVYQ 569
            ...:     ..|..|:::|..:::.:||||||..|.....:..||...:.|..|..|..|.:.|:
plant   606 YSTIKVPISRNSCQGYKKLQAVLRAIMLRRTKGTLLDGKPIINLPPKVVNLSQVDFSVAERSFYK 670

  Fly   570 ILSAISKKIFTQFLLQREKGNSDLNYYSLERTPQFIAGHMSDERYNEIYERFLKSLGYNPGEKIL 634
            .|.|.|:   :||....:.|....||.:                                     
plant   671 KLEADSR---SQFKAYADAGTLSQNYAN------------------------------------- 695

  Fly   635 GIYILVLLLRLRQFCCHPGLMIGMLRGALTAEDVQNVKVDASDVEGQLKMDVLAELDK------F 693
               ||:|||||||.|.||                |.||...||..|::....:..|.:      .
plant   696 ---ILLLLLRLRQACDHP----------------QLVKRYNSDPVGKVSEAAVRRLPREARSRLI 741

  Fly   694 DETDSEDDCCDE----------------------------EDSTRRDGNFKLEVIKDEI-KEENV 729
            :..:|....|.|                            :::|......|.::.:|.: .|.::
plant   742 NRLESSSAICYECNEPPEKPVVTLCGHIFCYECVLEYITGDENTCPVPRCKQQLARDVVFSESSL 806

  Fly   730 PWDSGDDLPTASSFEDQLDSARALKLLNPQNPIFQ---FIRPSAKLKMVIDKLEELLTGTND--- 788
            ...:.||...:||.::.||.:           :||   |.  |:|:|.|:|.|:.|....:.   
plant   807 RNCTSDDSGCSSSHDNGLDRS-----------VFQKRDFC--SSKIKAVLDILQSLSQPDSPNSA 858

  Fly   789 -----------------------------------KIIVTSQWVSYLAIVRKRLQDLSWETLDFN 818
                                               |.|:.|||...|.:|..|:.:...|....:
plant   859 QHGQMPSSSRPYDDDDVTIVEPMRLHSSSPSQGAVKTIIFSQWTGMLDLVELRILESGIEFRRLD 923

  Fly   819 GQLTAKEREIVLRDFNANNEKRVLLLSLTAGGVGLNLNVANHMLIVDLHWNPQLERQAQDRIYRY 883
            |.::...|:..:::|:...:.:|:|:||.||.:|||:..|.|::::||.|||..|.||.||.:|.
plant   924 GTMSLAARDRAVKEFSKKPDVKVMLMSLKAGNLGLNMVAACHVILLDLWWNPTTEDQAIDRAHRI 988

  Fly   884 GQTKPTFIYRYMCQDTVEQRIKSLQDCKLEIAKVVLPEE--GGEVTKCVGGGLNLAELKKLF 943
            |||:|..:.|...:||||.||..||:.|..:......||  |...|:     |.:.:||.||
plant   989 GQTRPVTVTRITIKDTVEDRILKLQEEKRTMVASAFGEEHGGSSATR-----LTVDDLKYLF 1045

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10445NP_001246974.1 SNF2_N 212..655 CDD:278600 142/509 (28%)
DEXDc <372..483 CDD:238005 53/164 (32%)
HELICc 761..892 CDD:238034 48/172 (28%)
AT3G20010NP_001319598.1 SNF2_N 284..713 CDD:278600 143/525 (27%)
DEXDc <416..579 CDD:238005 53/164 (32%)
RING 749..788 CDD:214546 3/39 (8%)
Helicase_C 894..989 CDD:278689 34/95 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D132523at2759
OrthoInspector 1 1.000 T32131
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45626
Phylome 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.