DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10445 and Ttf2

Sequence 1:NP_001246974.1 Gene:CG10445 FlyBaseID:FBgn0037531 Length:945 Species:Drosophila melanogaster
Sequence 2:NP_001013044.2 Gene:Ttf2 MGIID:1921294 Length:1138 Species:Mus musculus

Alignment Length:995 Identity:281/996 (28%)
Similarity:448/996 (45%) Gaps:246/996 (25%)


  Fly    13 HKQSCSIQDQSSVPVPDSSGE---INNWMEPEPVDSLELSGEYADNESAIFVSASEYNEKKAQID 74
            |..:.|.:|.....|....|.   .::.::.:...||:.|.:....:   ..:||..::|....|
Mouse   324 HHATSSSEDSEDDGVSSRPGSPLLFDSTVDSQKKGSLQHSDQSVQRQ---MPAASGVSKKGDSSD 385

  Fly    75 QLVQKI-LTMEQQQRQLEENASETKELCDLKLHLEKLNARLEALGEFLDTLRLREDQQEIKIEDN 138
            ...|:. ||.:.:|::....|...:.|.|..   |||..:::||.:.|..|.|..:|       .
Mouse   386 PAAQRANLTTQLKQKKGTLAAVNIQALPDKG---EKLLKQIQALEDALSALALSPEQ-------G 440

  Fly   139 SELVDHTEQPKWSNLYS-------------------------GLNRYRQKANHTAAQF------Y 172
            ::.....::|:.||:..                         ||...||:....|:|.      .
Mouse   441 TKEKCSAQEPEQSNITKAAAAPLHLVPPQPLPRPLIQPASSLGLKAGRQETPEGASQCSGGHMNQ 505

  Fly   173 QHKSNI----IDSLKTLYEPIQPRPAIDDLEKQPALLLVRLLKHQQSCLKWMQFRERQKISGGIL 233
            .|..|:    .:::..|:..::..|....:.:.||.|.|.||.||:..|.|:.:||.||..||||
Mouse   506 HHLYNVWKITSEAIDELHRSLKSCPGETAVAEDPAGLKVPLLLHQKQALAWLLWRESQKPQGGIL 570

  Fly   234 ADDMGLGKTLSMIALILASEETKNRKREEKKKALTLKWTQEFNRVYCKEIRKISMFDDEEESGKE 298
            ||||||||||:||||||..:..:..|.:|:.:.:|  |..:                        
Mouse   571 ADDMGLGKTLTMIALILTKKNQQKSKEKERSEPVT--WLSK------------------------ 609

  Fly   299 EEQYEPPEKRTCHVKTKKINQFRILDDDDNDAGDKAVVEDEQKDLLAKTPEPEVFSSDEEEEHLS 363
                                         ||:                    .||:         
Mouse   610 -----------------------------NDS--------------------SVFT--------- 616

  Fly   364 NGRYPSANTLVVCPMSVMCQWAHEVASKVAQNAIRVLTFHGPNRHEIGIEAFRSYDLVITSYNLV 428
                 |:.||:|||.|::..|.:||..:|..|.:|:..:|||||.. ..:...:||:|||:|:|:
Mouse   617 -----SSGTLIVCPASLIHHWKNEVEKRVTSNRLRIYLYHGPNRSR-HAKVLSTYDIVITTYSLL 675

  Fly   429 VNE--------------LKRYGNTSPLFAVYWNRVILDEAHIIRNSKTNCCNSVCQLRAHCHWAL 479
            ..|              |...|.::||..|.|.|:||||||.::|.:.....:||:|:|...||:
Mouse   676 AKEIPTTKQEGEVPGANLSVEGTSAPLLQVVWARIILDEAHNVKNPRVQTSIAVCKLQAQARWAV 740

  Fly   480 TGTPVQNRGVDVFALLRFVNVPNFQDLQQWKKNL-NESMLGHRRLNFIIKPLMLRRTKQKLQASG 543
            ||||:||..:|:::|::|:....|.:...||..: |.||.|..||:.:.|.|:|||||.:|.::|
Mouse   741 TGTPIQNNLLDMYSLMKFLRCSPFDEFSLWKSQVDNGSMKGGERLSILTKSLLLRRTKDQLDSTG 805

  Fly   544 -DMPALPSLKIELICVQLSKTEMAVYQILSAISKKIFTQFLLQREKGNSDLNYYSLERTPQFIAG 607
             .:.|||:.:.:|..::||:.|.|||.|..|.|:... |..|:|::|....:            |
Mouse   806 KPLVALPARRCQLHRLKLSEDERAVYDIFLARSRSAL-QSYLKRQEGRGSHH------------G 857

  Fly   608 HMSDERYNEIYERFLKSLGYN----PGEKILGIYILVLLLRLRQFCCHPGLMIGMLRGALTAEDV 668
            ...|..::.:.:.|..|:...    ..::...:::|..||||||.|||    :.:|:.||...::
Mouse   858 RSPDNPFSRVAQEFGSSVSQGCPAADSQRPSTVHVLSQLLRLRQCCCH----LSLLKSALDPTEL 918

  Fly   669 QNVKVDASDVEGQLKMDVLAELDKFD--ETDSEDDCCDEEDSTRRDGNFKLEVIKDEIKEENVPW 731
            ::..:..| :|.||....|:::|..:  .|.|.:..|           ||.|:..|         
Mouse   919 ESEGLVLS-LEEQLSALTLSKVDVSEPSPTVSLNGTC-----------FKAELFDD--------- 962

  Fly   732 DSGDDLPTASSFEDQLDSARALKLLNPQNPIFQFIRPSAKLKMVIDKLEELLTGT-NDKIIVTSQ 795
                                              .|.|.|:..::.:||.:..|. :.|.::.||
Mouse   963 ----------------------------------TRRSTKVSSLLAELEAIQKGPGSQKSVIVSQ 993

  Fly   796 WVSYLAIVRKRLQD--LSWETLDFNGQLTAKEREIVLRDFNANNEKRVLLLSLTAGGVGLNLNVA 858
            |.|.|.:|...|:.  |::.|:|  |.:..|:|..::..||.:...:|:|:||.||||||||...
Mouse   994 WTSMLQVVALHLKKNRLTYATID--GSVNPKQRMDLVEAFNHSQGPQVMLISLLAGGVGLNLTGG 1056

  Fly   859 NHMLIVDLHWNPQLERQAQDRIYRYGQTKPTFIYRYMCQDTVEQRIKSLQDCKLEIAKVVLPEEG 923
            ||:.::|:||||.||.||.|||||.||.|...|:|::|:.|||::|..||:.|.::||.||....
Mouse  1057 NHLFLLDMHWNPSLEDQACDRIYRVGQKKDVVIHRFVCEGTVEEKILQLQEKKKDLAKQVLSGSE 1121

  Fly   924 GEVTKCVGGGLNLAELKKLF 943
            |.|||     |.||:||.||
Mouse  1122 GPVTK-----LTLADLKILF 1136

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10445NP_001246974.1 SNF2_N 212..655 CDD:278600 140/463 (30%)
DEXDc <372..483 CDD:238005 48/125 (38%)
HELICc 761..892 CDD:238034 54/134 (40%)
Ttf2NP_001013044.2 zf-GRF 4..44 CDD:284302
MIP-T3 <132..464 CDD:287245 31/153 (20%)
SNF2_N 549..909 CDD:278600 140/467 (30%)
DEXDc 566..744 CDD:238005 77/268 (29%)
DEAH box 713..716 3/3 (100%)
Helicase_C 966..1082 CDD:278689 49/118 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0141
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D132523at2759
OrthoFinder 1 1.000 FOG0003166
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45626
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2250
TreeFam 1 0.960
87.910

Return to query results.
Submit another query.