DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10445 and hltf

Sequence 1:NP_001246974.1 Gene:CG10445 FlyBaseID:FBgn0037531 Length:945 Species:Drosophila melanogaster
Sequence 2:XP_005163433.1 Gene:hltf ZFINID:ZDB-GENE-030131-3306 Length:942 Species:Danio rerio

Alignment Length:833 Identity:207/834 (25%)
Similarity:350/834 (42%) Gaps:210/834 (25%)


  Fly   180 DSLKTLYEPIQPRPAIDDL------EKQPA-LLLVRLLKHQQSCLKWMQFRER------------ 225
            :.||..::.:     .|||      |.:|| .:...||.||:..|.||..||.            
Zfish   195 EELKNAFDKL-----FDDLMEDKTKEMEPAEAVCTPLLSHQKQALSWMSSRENSNDLPPFWEENK 254

  Fly   226 ----------------QKISGGILADDMGLGKTLSMIALILAS-----------------EETKN 257
                            :|:.||||||||||||||:.||||:::                 ...|.
Zfish   255 GLYFNVLTNFAVKKRPEKVLGGILADDMGLGKTLTTIALIVSNFHNGKPLPLEKCKGPSMPSAKR 319

  Fly   258 RKREEKKKALTLKWTQE------FNRVYCKEIRKISMFDDEEESGKEEEQYEPPEKRTCHVKTKK 316
            ::...|:|.:..:.:||      ..|::...:|         |:|        |:|:|...|.|.
Zfish   320 KQATSKEKGVDSEESQESMGLSPLKRLHDDTVR---------ENG--------PQKKTKTTKKKS 367

  Fly   317 INQFR--ILDDDDNDAGDKAVVEDEQKDLLAKTPEPEVFSSDEEEEHLSNGRYPSANTLVVCPMS 379
            .|..:  :|.||...|   |.:|.....::   |..:..........:|.|....| ||:|||:|
Zfish   368 ANTKKAVVLLDDVEFA---AALECSSSQVV---PSKKCVKKSSVPSEISAGSVARA-TLIVCPLS 425

  Fly   380 VMCQWAHEVASKVAQN-AIRVLTFHGPNRHEIGIEAFRSYDLVITSYNLVVNELKRYGN--TSPL 441
            |:..|..:....:..: .::|..::|..|:. .:......|:|:|:||::.::   :||  :|||
Zfish   426 VLSNWLDQFEQHIRTDVTVKVYLYYGSERNR-SVSLLSEQDVVLTTYNVLSSD---FGNKASSPL 486

  Fly   442 FAVYWNRVILDEAHIIRNSKTNCCNSVCQLRAHCHWALTGTPVQNRGVDVFALLRFVNVPNFQDL 506
            ..|.|.||:|||.|::||.......:|.:|::...|.|:|||:||...|:|.||.|:.:..| |:
Zfish   487 HNVKWLRVVLDEGHVVRNPNALQSKAVLELQSERRWILSGTPIQNSLKDLFMLLSFLKLKPF-DV 550

  Fly   507 QQWKKNLNE------SMLGHRRLNFIIKPLMLRRTKQKLQASGDMPALPSLKIELICVQLSKTEM 565
            ::|...:.:      ..:|.:.|..::|.:.|||||........:..||..::.:..|.||..|.
Zfish   551 KEWWSRIIQRPVTMGDRVGLKNLQALVKGITLRRTKNSKVGGRTLVQLPERRVFVQYVTLSGMER 615

  Fly   566 AVYQILSAISKKIFTQFLLQREKGNSDLNYYSLERTPQFIAGHMSDERYNEIYERFLKSLGYNPG 630
            ..|:.:....|.|..::.   ::|....||..                                 
Zfish   616 EKYERVKGEGKNIVGRYF---QEGTFMANYAD--------------------------------- 644

  Fly   631 EKILGIYILVLLLRLRQFCCHPGLMIGMLRGALTAEDVQNVKVDASDVEGQLKMDVLAELDKFDE 695
                   :|.:|:||||.||||.|:     |..||.||..       ...:|:..::.::.....
Zfish   645 -------VLTILMRLRQCCCHPSLV-----GNYTAADVPG-------TPSELRERLIQKITLVLN 690

  Fly   696 TDSEDDCCDEEDSTRR----------------------DGNFKLEVIKDEIKEENVPWDSGDDLP 738
            :.|:::|....||.|:                      ....|..:.:.:||.:.:....|:...
Zfish   691 SGSDEECAICLDSLRQPVITYCAHVFCRPCICEVIRSEKEQAKCPLCRAQIKTKELVEYPGEQAE 755

  Fly   739 TAS-SFEDQLDSARALKLLNPQNPIFQFIRPSAKLKMVIDKLEELLTGTND----KIIVTSQWVS 798
            |.| :.|:...|::||.|::                       .||...|:    |.:|.||:..
Zfish   756 TRSDTGENWRSSSKALALMS-----------------------NLLKLRNEDPTVKSMVVSQFTG 797

  Fly   799 YLAIVRKRLQDLSWETLDFNGQLTAKEREIVLRDF--NANNEKRVLLLSLTAGGVGLNLNVANHM 861
            :|.::...|::..:.....:|.|..:.|...:.||  :......::||||.||||||||..|:.:
Zfish   798 FLDVLEVALREYGFSFTRLDGSLIQRARAKAIEDFQDSTPGSPTIMLLSLKAGGVGLNLTAASQV 862

  Fly   862 LIVDLHWNPQLERQAQDRIYRYGQTKPTFIYRYMCQDTVEQRIKSLQDCKLEI 914
            .::|..|||..|.|..||.:|.||::...|.:::.:|:||:.:..:|..|.|:
Zfish   863 FVMDPAWNPAAEDQCVDRCHRLGQSRDVVITKFIVKDSVEENMVKIQKKKQEL 915

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10445NP_001246974.1 SNF2_N 212..655 CDD:278600 130/505 (26%)
DEXDc <372..483 CDD:238005 37/114 (32%)
HELICc 761..892 CDD:238034 39/137 (28%)
hltfXP_005163433.1 HIRAN 59..144 CDD:214906
SNF2_N 229..662 CDD:278600 130/505 (26%)
DEXDc <418..528 CDD:238005 37/114 (32%)
RING 696..741 CDD:238093 5/45 (11%)
Helicase_C 767..885 CDD:278689 40/141 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D132523at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2250
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.040

Return to query results.
Submit another query.