DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10445 and rad8

Sequence 1:NP_001246974.1 Gene:CG10445 FlyBaseID:FBgn0037531 Length:945 Species:Drosophila melanogaster
Sequence 2:NP_001342793.1 Gene:rad8 PomBaseID:SPAC13G6.01c Length:1133 Species:Schizosaccharomyces pombe

Alignment Length:987 Identity:226/988 (23%)
Similarity:386/988 (39%) Gaps:316/988 (32%)


  Fly    82 TMEQQQRQLEENASETKELCDLKL--------HLEKLNARLEALGEFLDTLRLREDQQEIKIEDN 138
            :|::::..|:.:.::.|....|:|        .||..|.: |::  .:|.:.......|.:.|.|
pombe   338 SMQEEEEHLKASFAQNKRDHLLRLFTWIALEPDLEDCNTK-ESI--HIDDILKTSSLPEARDESN 399

  Fly   139 SELVDHTEQPKWSNLYSGLNRYRQKANHTAAQFYQHKSNIIDSLKTLYEPIQPRPAIDDLEKQPA 203
            |:|                         |.:.....:..:.|.|..||:.::...|......:|:
pombe   400 SDL-------------------------TPSSTEDEEDVVSDQLAILYDKVKTSGAELPSAPKPS 439

  Fly   204 LLLVRLLKHQQSCLKWM-----------------------------QFRERQKIS---------- 229
            ...:.|.::|:..|.||                             :|.|..|.|          
pombe   440 TFALDLREYQKQALYWMCCKEEGVQSDGSAPKLHPLWSRFRFPKDSEFPEFFKCSSDDDNTHFYV 504

  Fly   230 -------------------GGILADDMGLGKTLSMIALILASEETKNRKREEKKKALTLKWTQEF 275
                               ||||||:||||||:.:::||                          
pombe   505 NLYTGETTMLFPNSMPYHRGGILADEMGLGKTIEVLSLI-------------------------- 543

  Fly   276 NRVYCKEIRKISMFDDEEESGKEEEQYEPPEKRTCHVKTKKINQFRILDDDDNDAGDKAVVEDEQ 340
                                          ..|.|                              
pombe   544 ------------------------------HSRPC------------------------------ 548

  Fly   341 KDLLAKTPEPEVFSSDEEEEHLSNGR----YPSANTLVVCPMSVMCQWAHEVASKVAQNA-IRVL 400
                        ||:||..|...:.:    ..|..||||.|||::.|| |..|.||:|.. .|.:
pombe   549 ------------FSTDEIPEAFRHSKPSLPVASRTTLVVAPMSLLDQW-HSEACKVSQGTKFRSM 600

  Fly   401 TFHGPNR----HEIGIEAFRSYDLVITSYNLVVNELKRYGNTSPLFAVYWNRVILDEAHIIRN-- 459
            .::|..:    ....|:...:..::||||.::::|..:..::|.||:|:|.||:|||.|.|||  
pombe   601 IYYGSEKPLDLKSCVIDTSTAPLIIITSYGVLLSEFSQQSHSSGLFSVHWFRVVLDEGHNIRNRE 665

  Fly   460 SKT-NCCNSVCQLRAHCHWALTGTPVQNRGVDVFALLRFVNVPNFQDLQQWK------------- 510
            ||| ..|:|:   .:...|.:||||:.|:..|:::|::|:....:.:...|:             
pombe   666 SKTAKACHSI---SSQNRWVITGTPIVNKLDDLYSLIKFMRYEPWCNYTYWQTFVSLPYQSKDVL 727

  Fly   511 KNLNESMLGHRRLNFIIKPLMLRRTKQKLQASGD-MPALPSLKIELICVQLSKTEMAVYQILSAI 574
            |.||.       :..|::.|:|||||:....:|: :..||...:::..:..|.:|..:|.     
pombe   728 KALNV-------VQSILEFLVLRRTKETKDRNGNSIVTLPPKTVKIEYLDFSDSERKIYD----- 780

  Fly   575 SKKIFTQFLLQREKGNSDLNYYSLERTPQFIAGHMSDERYNEIYERFLKSLGYNPGEKILGIYIL 639
              .::|       |..|.:|       ...:||        .::..:...||             
pombe   781 --SLYT-------KAKSTVN-------ANIVAG--------TLFRNYTTILG------------- 808

  Fly   640 VLLLRLRQFCCHPGLMIGMLRGALTAEDVQ------NVKVDASDVEGQ------LKMDVLAELDK 692
             |||||||.||.|.|:..|...:.|.:|.:      |..::...|.|:      ||:|.   |..
pombe   809 -LLLRLRQACCDPVLLSNMTINSETFDDFEFSVEQFNSLINQFVVTGKPIPSDILKIDT---LKS 869

  Fly   693 FDETDSE-DDCCDEEDSTRRDGNFKL----EVIKDEI---KEENV----------PWDSGDDLPT 739
            |:...:| ..||:|........|.|.    :.:.:.|   |..|:          |::..|   .
pombe   870 FEALITECPICCNEPIQNPLLLNCKHACCGDCLSEHIQYQKRRNIIPPLCHTCRQPFNEQD---V 931

  Fly   740 ASSFEDQLDSARALKLLNPQNPIFQFIR-PSAKLKMVIDKLEELLTGTN-DKIIVTSQWVSYLAI 802
            ...|..:.:..::..|:..:.....:.| .|.||..::.:|.:|...:. :|:::.||:.::|.|
pombe   932 YKPFFVKNNGTQSTLLVGEEVKWKYWNRLQSVKLNGLLGQLRQLTHSSEPEKVVIFSQFTTFLDI 996

  Fly   803 VRKRLQDLSWETLDFNGQLTAKEREIVLRDFNANNEKRVLLLSLTAGGVGLNLNVANHMLIVDLH 867
            :...|:........|:|.::.:.|...|..|..:.:..||::||.||||||||..|||:.|:|..
pombe   997 IADVLESEKMGYARFDGTMSQQMRSTALETFRNDPDVNVLIISLKAGGVGLNLTCANHVFIMDPW 1061

  Fly   868 WNPQLERQAQDRIYRYGQTKPTFIYRYMCQDTVEQRIKSLQDCKLEIAKVVLPEEGGEVTKCVGG 932
            |:..:|.||.|||:|.||.||.|:.||:.:||||:|:..:|:.|..|...:...||.:..:    
pombe  1062 WSWSVEAQAIDRIHRLGQEKPVFVTRYIVRDTVEERMLKIQERKNFITGTLGMSEGKQQVQ---- 1122

  Fly   933 GLNLAELKKLFE 944
              ::.::|.|||
pombe  1123 --SIEDIKMLFE 1132

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10445NP_001246974.1 SNF2_N 212..655 CDD:278600 116/527 (22%)
DEXDc <372..483 CDD:238005 45/119 (38%)
HELICc 761..892 CDD:238034 47/133 (35%)
rad8NP_001342793.1 HIRAN 209..316 CDD:214906
HepA <521..1133 CDD:223627 195/777 (25%)
RING-HC_SpRad8_like 874..923 CDD:319486 9/49 (18%)
RING-HC finger (C3HC4-type) 877..922 CDD:319486 8/45 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T133333
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2250
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.