DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10445 and Hltf

Sequence 1:NP_001246974.1 Gene:CG10445 FlyBaseID:FBgn0037531 Length:945 Species:Drosophila melanogaster
Sequence 2:XP_006232237.1 Gene:Hltf RGDID:1309031 Length:1018 Species:Rattus norvegicus

Alignment Length:1046 Identity:246/1047 (23%)
Similarity:416/1047 (40%) Gaps:290/1047 (28%)


  Fly    31 SGEINN----WMEPEPVDSLELSGEYADNESAIFVSASEYNEKKAQIDQLVQKILTMEQQQRQLE 91
            :|.:||    .:|.||.:..:.:....:|     |:.::....|..:...:..|  |:.:..|:|
  Rat    74 TGVVNNNEMVALEREPNNPYDKNAIKVNN-----VNGNQVGHLKRDLAAALAYI--MDNKLAQVE 131

  Fly    92 E----NASETKELCDLKLHLEKLNARLEALGEFLDTLRLREDQQEIKIEDNSELVDHTEQ----- 147
            .    .||.|   ..:.||:               |...:|:.:|:       ::||.::     
  Rat   132 GVVPFGASNT---FTMPLHM---------------TFWGKEENREV-------VLDHLKKHGFKL 171

  Fly   148 ---PK---------WSNLYSGLNRYRQKANHTAAQFYQHKSNIIDSLKTLYEPIQPRPAIDD--L 198
               ||         |.:..:|.:..|..  |.|.|.      ..:.|||.::.:......||  :
  Rat   172 GPTPKTVGSSLENTWGSGRAGPSYSRPV--HVAVQM------TTEQLKTEFDKLFEDLKEDDRTI 228

  Fly   199 EKQPA-LLLVRLLKHQQSCLKWMQFRERQK----------------------------ISGGILA 234
            |.:|| .:...||.||:..|.||..||..|                            :.|||||
  Rat   229 EMEPAEAVETPLLPHQKQALAWMIARENSKELPPFWELRNDLYYNTITNFSVKERPENVHGGILA 293

  Fly   235 DDMGLGKTLSMIALILASEET------KNRK-----REEKKKALTLKWT---------------- 272
            |||||||||:.||:||.:.:.      |..|     :|.|.:.:.|:.:                
  Rat   294 DDMGLGKTLTAIAVILTNFDDGRPLLGKRGKESHPGKEYKDETVKLRGSNTNKTTDGHSEPSACS 358

  Fly   273 --------QEFNRV-----YCKEIRKISMFDDEEESGKEEEQYEPPEKRTCHVKTKKINQFRILD 324
                    .|.:.|     :..:.||||:...|....:|.|..:..:|....:|..:      ||
  Rat   359 EEPSISDVSEKSNVSDLFSFFSKRRKISVQSTESSESEEIETSKLSQKMKGKLKNTQ------LD 417

  Fly   325 DDDNDAGDKAVVEDEQ-------------KDLLAKTPEPEVFSSDEEEEHLSNGRYPSANTLVVC 376
            ......|...:.||.|             |.:|.|..     |..|..:....|. .:..||::|
  Rat   418 TKSKVKGSSKIKEDTQFALALTYFGPATKKKMLKKGT-----SVMESSKKCDTGE-RTRTTLIIC 476

  Fly   377 PMSVMCQW-------------------AHEVASKVAQNAIRVLTFHGPNRHEIGIEAFRS-YDLV 421
            |:||:..|                   ...:.|:|..|   :..::||:|  |....:.| .|::
  Rat   477 PLSVLSNWILFSLISLRFFMKYTQDQIGQHIKSEVDLN---LYVYYGPDR--IRDSTWLSKQDII 536

  Fly   422 ITSYNLVVNELKRYG--NTSPLFAVYWNRVILDEAHIIRNSKTNCCNSVCQLRAHCHWALTGTPV 484
            :|:||::.::   ||  :.|||.::.|.||||||.|.|||.......:|.:|.|...|.|||||:
  Rat   537 LTTYNILTHD---YGTKDNSPLHSIKWLRVILDEGHAIRNPNAQQTKAVLELEAERRWVLTGTPI 598

  Fly   485 QNRGVDVFALLRFVNVPNFQDLQQWKKNLNESML-----GHRRLNFIIKPLMLRRTKQKLQASGD 544
            ||...|:::||.|:.:..|.|.:.|.:.:...:.     |.|||..:||.:.|||||........
  Rat   599 QNSLKDLWSLLSFLKLKPFTDREWWHRIIQRPVTTGDEGGLRRLQSLIKSITLRRTKTSKIKGKP 663

  Fly   545 MPALPSLKIELICVQLSKTEMAVYQILSAISKKIFTQFLLQREKGNSDLNYYSLERTPQFIAGHM 609
            :..||..|:.:..:.||..|..:||.:              :.:|.:.:..|..|.|   :..|.
  Rat   664 VLELPERKVFIQHITLSVEERKIYQSV--------------KNEGKATIARYFTEGT---VLAHY 711

  Fly   610 SDERYNEIYERFLKSLGYNPGEKILGIYILVLLLRLRQFCCHPGLMIGMLRGALTAEDVQNVKVD 674
            :|                          :|.|||||||.|||    :.:.....::.|...    
  Rat   712 AD--------------------------VLGLLLRLRQICCH----VHLPTNGTSSSDPSR---- 742

  Fly   675 ASDVEGQLKMDVLAELDKFDETDSEDDC----------------------CDEEDSTRRDGNFKL 717
             ||...:|:..::.::.....:.|:::|                      |..:...|...:.|.
  Rat   743 -SDTPEELRKMLVTKMKLILSSGSDEECSICLDSLTFPVITHCAHVFCKPCICQVIQREQPHAKC 806

  Fly   718 EVIKDEIKEENVPWDSGDDLPTASSFEDQLDSARALKLLNPQNPIFQFIRPSAKLKMVIDKLEEL 782
            .:.:..|...|:.....::|...|..:..::..                 .|:|:..:::.|.||
  Rat   807 PLCRSNIHGHNLLECPPEELACDSDNKSDMEWT-----------------SSSKINALMNALIEL 854

  Fly   783 LT-GTNDKIIVTSQWVSYLAIVRKRLQDLSWETLDFNGQLTAKEREIVLRDFNANN--EKRVLLL 844
            .| ..|.|.:|.||:.::|:::...|:...:.....:|.:..|:|...::.|...:  ...::||
  Rat   855 RTKDPNIKSLVVSQFTTFLSLIETPLKASGFVFTRLDGSMAQKKRVESIQCFQNTDAGSPTIMLL 919

  Fly   845 SLTAGGVGLNLNVANHMLIVDLHWNPQLERQAQDRIYRYGQTKPTFIYRYMCQDTVEQRIKSLQD 909
            ||.||||||||..|:.:.::|..|||..|.|..||.:|.||.:...|.:::.:|:||:.:..:|:
  Rat   920 SLKAGGVGLNLCAASRVFLMDPAWNPAAEDQCFDRCHRLGQKQEVIITKFIVKDSVEENMLKIQN 984

  Fly   910 CKLEIA 915
            .|.|:|
  Rat   985 MKRELA 990

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10445NP_001246974.1 SNF2_N 212..655 CDD:278600 143/551 (26%)
DEXDc <372..483 CDD:238005 43/133 (32%)
HELICc 761..892 CDD:238034 42/134 (31%)
HltfXP_006232237.1 HIRAN 60..155 CDD:285949 20/106 (19%)
DEXDc 238..>316 CDD:214692 28/78 (36%)
SNF2_N 472..727 CDD:278600 88/306 (29%)
DEXDc <472..597 CDD:238005 43/133 (32%)
RING 768..813 CDD:238093 4/45 (9%)
Helicase_C 841..959 CDD:278689 39/118 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D132523at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.