DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10445 and SPAC17A2.12

Sequence 1:NP_001246974.1 Gene:CG10445 FlyBaseID:FBgn0037531 Length:945 Species:Drosophila melanogaster
Sequence 2:NP_594246.1 Gene:SPAC17A2.12 PomBaseID:SPAC17A2.12 Length:897 Species:Schizosaccharomyces pombe

Alignment Length:857 Identity:219/858 (26%)
Similarity:354/858 (41%) Gaps:252/858 (29%)


  Fly   172 YQHKSNIIDSLKTLYEPIQ---PRP--AID----DLEKQPALLLVRLLKHQQSCLKWMQFRERQK 227
            |:.|.......|.|::.:|   |.|  .||    :.:.|.|.|||.||.||.....||:..|:..
pombe   204 YERKVQPEHVTKELHQLLQHNTPSPFDTIDLQLKNEQVQSAGLLVSLLPHQVEGHAWMESMEQSS 268

  Fly   228 ISGGILADDMGLGKTLSMIALILASEETKNRKREEKKKALTLKWTQEFNRVYCKEIRKISMFDDE 292
            ..||::|||||||||:..|||:|                     ||                   
pombe   269 KCGGVMADDMGLGKTIQTIALLL---------------------TQ------------------- 293

  Fly   293 EESGKEEEQYEPPEKRTCHVKTKKINQFRILDDDDNDAGDKAVVEDEQKDLLAKTPEPEVFSSDE 357
                                                          :.:|.|.||          
pombe   294 ----------------------------------------------KSQDPLRKT---------- 302

  Fly   358 EEEHLSNGRYPSANTLVVCPMSVMCQWAHEVASKV-AQNAIRVLTFHGPNRHEIGIEAFRSYDLV 421
                          .|:|..::::.|||.|:::|| ....:.|...||..:..:.......||:|
pombe   303 --------------NLIVVSVALLHQWAEELSTKVHPSKKLSVYIHHGSTKKNLDSYELSQYDVV 353

  Fly   422 ITSYNLVVNELKR---YGNTSP----------LFAVYWNRVILDEAHIIRNSKT---NCCNSVCQ 470
            :|:|:::..|:|:   :.|.:|          |....|.|::|||||.|||..|   .||   .:
pombe   354 LTTYSMLAYEMKQNDAFNNNNPATATPPPACSLLETSWYRIVLDEAHTIRNRDTLAAKCC---VK 415

  Fly   471 LRAHCHWALTGTPVQNRGVDVFALLRFVNVPNF-----------QDLQQWKKNLNESMLGHRRLN 524
            |.|...|.|:|||:||...:.::||:|:.:..:           :.|:.::.::.|:.|  :||.
pombe   416 LDAKYRWCLSGTPIQNHIDEFYSLLKFLRIKPYCVWSLFAKDISRPLKSYRADIVEAAL--KRLR 478

  Fly   525 FIIKPLMLRRTKQKLQASGDMPALPSLKIELICVQLSKTEMAVY--QILSAISKKIFTQFLLQRE 587
            .::...:.||||:....:..:..||...|..:.|.|...|.|:|  |:.||       |.|:...
pombe   479 ILLASTVFRRTKETRVNNLPIVNLPPKTIRTVSVNLLPEERALYNEQMSSA-------QSLVDNY 536

  Fly   588 KGNS-DLNYYSLERTPQFIAGHMSDERYNEIYERFLKSLGYNPGEKILGIYILVLLLRLRQFCCH 651
            ..|. ||:.|.                                       ::||.||||||||||
pombe   537 FNNDHDLSRYG---------------------------------------FLLVSLLRLRQFCCH 562

  Fly   652 PGLM-IGMLRGALTAEDVQNVKVDASDVEGQLKMDVLAELDKFDETDSEDDC------------- 702
            |.|: ...|..:....|.:||:.....:: .|.::.:|.|..|:.:...|.|             
pombe   563 PWLVKSSSLDNSFRIRDSENVRNACKSLD-PLTIERIATLQDFNCSVCLDPCLAPVFIIPCGHFT 626

  Fly   703 CDEEDST---RRDGNFKLEVI--KDEIKEENVPWDSGDDLPTASSFEDQLDSARALKL------- 755
            |.|..|.   ::.|:.....|  |..:...|:..||..|.....:....|:|.:.|:|       
pombe   627 CQECMSMLVGQKYGSSSTSTIIAKCPMCRGNIVQDSLVDATILQAIHGPLNSLKQLELDMNQSFS 691

  Fly   756 ------LNPQNPIFQFI-----------RPSAKLKMVIDKLEELL-TGTNDKIIVTSQWVSYLAI 802
                  |..:|.|.|..           :.|:||......:.::: :..|:||:|.||:..||.:
pombe   692 EQESIKLRWENRIDQMFTKKFGKRASEWKSSSKLNQARQTILDIIGSKRNEKILVYSQFSQYLCL 756

  Fly   803 VRKRLQDLSWETLDFNGQLTAKEREIVLRDFNANNEKRVLLLSLTAGGVGLNLNVANHMLIVDLH 867
            |...|:..:...:.::|.::|.:|:..|..||.:.:..|:|:||.||.|||||.:|||:::.:..
pombe   757 VSHMLKLENIRHVRYDGTMSANQRQKSLHSFNNDKDVLVMLVSLKAGSVGLNLTIANHVILQEPF 821

  Fly   868 WNPQLERQAQDRIYRYGQTKPTFIYRYMCQDTVEQRIKSLQDCKLEIAKVVL-PEEGGEVTKCVG 931
            :||.:|.||.||::|.||.||..:||::.:||:|:||.|:|..|.::.|..| ..|...:::   
pombe   822 YNPSIEDQAIDRVHRLGQQKPVTVYRFITKDTIEERIVSVQRKKRQLVKEALDSNENNPLSR--- 883

  Fly   932 GGLNLAELKKLF 943
              |:..||..||
pombe   884 --LDKEELLYLF 893

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10445NP_001246974.1 SNF2_N 212..655 CDD:278600 112/474 (24%)
DEXDc <372..483 CDD:238005 40/128 (31%)
HELICc 761..892 CDD:238034 47/143 (33%)
SPAC17A2.12NP_594246.1 SNF2_N 253..566 CDD:278600 112/474 (24%)
DEXDc 271..428 CDD:238005 61/270 (23%)
RING 606..658 CDD:238093 9/52 (17%)
Helicase_C 729..838 CDD:278689 38/109 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 278 1.000 Inparanoid score I669
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T631703
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45626
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.160

Return to query results.
Submit another query.