DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10445 and SPBC582.10c

Sequence 1:NP_001246974.1 Gene:CG10445 FlyBaseID:FBgn0037531 Length:945 Species:Drosophila melanogaster
Sequence 2:NP_595178.1 Gene:SPBC582.10c PomBaseID:SPBC582.10c Length:830 Species:Schizosaccharomyces pombe

Alignment Length:828 Identity:211/829 (25%)
Similarity:357/829 (43%) Gaps:246/829 (30%)


  Fly   164 ANHTAAQFYQ-HKSNIIDSLKTLYEPIQPRPAIDDLEKQPAL---LLVRLLKHQQSCLKWMQFRE 224
            :.:|.|..:: .::|::|::|.           |.:::|.:.   :.:|||.||...|.|::.||
pombe   195 SQNTQAMLHKLFENNVLDNVKD-----------DSMQRQSSFIPGMHIRLLDHQVQGLTWLKSRE 248

  Fly   225 ---RQKISGGILADDMGLGKTLSMIALILASEETKNRKREEKKKALTLKWTQEFNRVYCKEIRKI 286
               :...||||||||||||||:.||||||:                                   
pombe   249 TVSKSSASGGILADDMGLGKTIQMIALILS----------------------------------- 278

  Fly   287 SMFDDEEESGKEEEQYEPPEKRTCHVKTKKINQFRILDDDDNDAGDKAVVEDEQKDLLAKTPEPE 351
                                    |...||                                   
pombe   279 ------------------------HPLPKK----------------------------------- 284

  Fly   352 VFSSDEEEEHLSNGRYPSANTLVVCPMSVMCQWAHEVASKVAQNAIRVLTFHGPNRHEIGIEAFR 416
                          ::...:||||.|:|::.||..||.:|   :.:..:.:||.:|::: ::...
pombe   285 --------------KHSIKSTLVVAPLSLIKQWESEVQTK---SKLTAIVYHGASRYKL-LKVIH 331

  Fly   417 SYDLVITSYNLVVN----------------ELKRYGNTSP-LFAVYWNRVILDEAHIIRNSKTNC 464
            .||:|||:|.::|:                |.|.|....| |||.||.|:||||||.|:|..:..
pombe   332 EYDVVITTYQILVSEWVSHNTTGTDGKSPTEAKSYEKKKPSLFAFYWWRIILDEAHTIKNKSSKS 396

  Fly   465 CNSVCQLRAHCHWALTGTPVQNRGVDVFALLRFVNVPNFQDLQQWKKNLN------ESMLGHRRL 523
            ..:.|.|:....|.|||||:||...::::|::|:::..|.|...||..::      |..|..:||
pombe   397 ALACCALQGINRWCLTGTPLQNNVDELYSLVKFLHINPFNDQSVWKDQISLPLCQGEENLVFKRL 461

  Fly   524 NFIIKPLMLRRTKQKLQASGDMPALPSLKIELICVQLSKTEMAVYQILSAISKKIFTQFLLQREK 588
            ..::..:||||||..|:|:........      .::|||  ..||:::....:            
pombe   462 RMLLSVIMLRRTKTLLEANAGKDGTGG------ALKLSK--RLVYKVICKFEE------------ 506

  Fly   589 GNSDLNYYS-----LERTPQFIAGHMSDERYNEIYERFLKS--LGYNPGEKILGIY--ILVLLLR 644
              |:.::||     :|||       ||:         |:.|  ||.|        |  ||.||||
pombe   507 --SERDFYSNLARNMERT-------MSN---------FVNSGKLGKN--------YTNILCLLLR 545

  Fly   645 LRQFCCHPGLMIGMLRGALTAEDVQNVKVDASDVEGQLKMDVLAELDKFDETDSEDDCCDEEDST 709
            |||.|.||..:              |.:.: .||:....:|..|..:|.......||..:     
pombe   546 LRQACNHPQSL--------------NFQFE-QDVDAFNALDGAANTNKLASDQDVDDLAN----- 590

  Fly   710 RRDGNFKLEVIKDEIKEENVPWDSGDDLPTASSFEDQLDSARALKLLNP--QNPIFQFIRPSAKL 772
                  .||.::...::::.......:||.....:...|.:|..|.|:.  |:|..:.:..|:|:
pombe   591 ------LLETVEIGSRKKSFCTICMAELPPDFHEKKCKDCSRNFKELDKGIQDPNDKTLYKSSKI 649

  Fly   773 KMV-----IDKLEE--LLTGTNDKIIVTSQWVSYLAIVRKRLQDLSWETLDFNGQLTAKEREIVL 830
            :.:     :|:.||  .:.|.. |.|:.||:.::|.|:...|:......:.::|::..:.||..|
pombe   650 REILKILSLDEQEEDDTVRGLR-KTIIFSQFTTFLDIIDLHLRKAGIGFVRYDGRMNNRAREKSL 713

  Fly   831 RDFNANNEKRVLLLSLTAGGVGLNLNVANHMLIVDLHWNPQLERQAQDRIYRYGQTKPTFIYRYM 895
            ....:::..:|||.||..|.:||||..|:.:::.|:.|||.:|.||.||::|.||.:...:|:.:
pombe   714 DLLRSDSGTQVLLCSLKCGALGLNLTCASRVILCDVWWNPAIEEQAIDRVHRIGQRRDVLVYKLV 778

  Fly   896 CQDTVEQRIKSLQDCKLEIAKVVLPEEGGEVTKCVGGGLNLAELKKLF 943
            .::|:|::|..||:.|.::||..|.:  |:.:......|.|.:|..||
pombe   779 VENTIEEKIVELQNLKRDLAKQALGD--GKKSVFTSKKLTLNDLLFLF 824

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10445NP_001246974.1 SNF2_N 212..655 CDD:278600 127/478 (27%)
DEXDc <372..483 CDD:238005 46/128 (36%)
HELICc 761..892 CDD:238034 41/138 (30%)
SPBC582.10cNP_595178.1 SNF2_N 236..554 CDD:278600 127/476 (27%)
DEXDc 256..415 CDD:238005 69/271 (25%)
Helicase_C 646..767 CDD:278689 38/122 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 278 1.000 Inparanoid score I669
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003166
OrthoInspector 1 1.000 T133333
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45626
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2250
TreeFam 00.000 Not matched by this tool.
77.190

Return to query results.
Submit another query.