DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10445 and SPBC23E6.02

Sequence 1:NP_001246974.1 Gene:CG10445 FlyBaseID:FBgn0037531 Length:945 Species:Drosophila melanogaster
Sequence 2:NP_596602.1 Gene:SPBC23E6.02 PomBaseID:SPBC23E6.02 Length:1040 Species:Schizosaccharomyces pombe

Alignment Length:1073 Identity:257/1074 (24%)
Similarity:415/1074 (39%) Gaps:355/1074 (33%)


  Fly     3 SSSPSDTTEIHKQSCSIQDQS-------------------------SVPVPDSSGEINNWMEPEP 42
            |.|.||...:..:| |:.|..                         |:||..::|       |..
pombe   190 SDSESDDNNVRTKS-SLNDHDKVNMKEKRNLELAFMNSKRKKLELPSLPVLSTAG-------PSY 246

  Fly    43 VDSLELSGEYADNESAIFVSASEYNEKKAQIDQLVQ-------KILTMEQQQRQL----EENASE 96
            .:||.|...:..|...:|.:.....:     |:.:|       .|...:::..::    :...|:
pombe   247 TNSLALPPFHHHNNYKMFNTTHTLED-----DKFLQGKGTSNNPISLSDEEDNEINFQNKRYGSD 306

  Fly    97 TKELCDLKLHLEKLNARLEALGEFLDTLRLREDQ----QEIKIED-NSELVDHTEQPKWSNLYSG 156
            :..|....||    :::|...|:.|..|:...|:    :...:.| |::.|...:|.:...|:  
pombe   307 SVILPGGLLH----DSKLPEPGKHLFHLQWYHDRFHNIEGFNLSDSNNQKVQDDQQQQLEELF-- 365

  Fly   157 LNRYRQKANHTAAQFYQHKSNIIDSLKTLYEPIQPRPAIDDLEKQPALLLVRLLKHQQSCLKWMQ 221
                                      |.|.|.:...|.|  .|..||.|:..|::||:..|.|::
pombe   366 --------------------------KDLDEQLVNDPTI--REGTPAGLIPTLMEHQKEGLMWLK 402

  Fly   222 FRERQKISGGILADDMGLGKTLSMIALILASEETKNRKREEKKKALTLKWTQEFNRVYCKEIRKI 286
            ..|.....|||||||||||||:..:||::.                                   
pombe   403 RLEESSKKGGILADDMGLGKTVQALALLVT----------------------------------- 432

  Fly   287 SMFDDEEESGKEEEQYEPPEKRTCHVKTKKINQFRILDDDDNDAGDKAVVEDEQKDLLAKTPEPE 351
                            .|||.::  |||                                     
pombe   433 ----------------RPPESKS--VKT------------------------------------- 442

  Fly   352 VFSSDEEEEHLSNGRYPSANTLVVCPMSVMCQWAHEVASKVA-QNAIRVLTFHGPN-RHEIGIEA 414
                                ||::.|:|::.||.:|:.:|:| .:...|...||.: :|:|. |.
pombe   443 --------------------TLIITPVSLLQQWHNEILTKIAPSHRPTVYIHHGSSKKHKIA-EQ 486

  Fly   415 FRSYDLVITSYNLVVNELKR---YGNT------------SPLFAVYWNRVILDEAHIIRNSKTNC 464
            ..|||:|:|:||::..|.|.   |..:            .|.|...|.|||||||..|:|..|..
pombe   487 LMSYDIVLTTYNVIAYEFKNKMAYDKSIEDNAPIKKFEHLPFFEAEWYRVILDEAQTIKNRNTLA 551

  Fly   465 CNSVCQLRAHCHWALTGTPVQNRGVDVFALLRFVNVPNFQDLQQWKK--------NLNESMLGHR 521
            ....|.|.:...|.|:|||:||...:.::|::|:.:..:.|...:.|        |:|.| ...:
pombe   552 ARGCCLLESTYRWCLSGTPMQNGVEEFYSLIKFLRIKPYSDWSSFSKDFTIPLSSNINTS-APMK 615

  Fly   522 RLNFIIKPLMLRRTKQ-KLQASG--DMPALPSLKIELICVQLSKTEMAVYQILSAISKKIFTQFL 583
            |...::|.::|||||. |:....  .:|...::|.|   ..||.:||..|..|.:.::....::|
pombe   616 RFRGLLKAVLLRRTKNTKIDGKPILTLPPKTAVKSE---TDLSSSEMEFYNTLQSGAQIQMRKYL 677

  Fly   584 LQREKGNSDLNYYSLERTPQFIAGHMSDERYNEIYERFLKSLGYNPGEKILGIYILVLLLRLRQF 648
               ::|....:|.||                                        |||||||||.
pombe   678 ---QEGTITTHYGSL----------------------------------------LVLLLRLRQA 699

  Fly   649 CCHPGLMIG----------------MLRGALTAEDVQNVKVDASDVEGQLKMDVLAEL------- 690
            ||||.|::.                .:...:..|.|..:|: ...::..|.|||:|||       
pombe   700 CCHPWLIVAREAAVDDNDSFQAKNRAIYNQIYPEAVNRLKL-IETLQCSLCMDVVAELLIIVPCG 763

  Fly   691 ----------------DKFDETDSED-----DCCDEEDSTRR----------DGNFKLEVIKDEI 724
                            |...:|.:|:     ..|:|...|.|          .|...:....:::
pombe   764 HFLCRECLTHVITSSEDMAKQTSNENISPKCSVCEEYIDTERLLSYALFRRYSGMAPIVDADNKL 828

  Fly   725 KEENVPWDSGDDLPTASSFEDQLDSARALKLLNPQNPIFQFIRP-----SAKLKMVIDKLEELL- 783
            :.||:    .:.||  ..:.:.|:        |.|..:..|..|     |.|::..::.::|:: 
pombe   829 RTENI----SELLP--KQYSNILE--------NRQMGMKIFTDPKHWTTSTKIEKALNAVKEIIK 879

  Fly   784 TGTNDKIIVTSQWVSYLAIVRKRLQDLSWETLDFNGQLTAKEREIVLRDFNANNEKRVLLLSLTA 848
            ....|||::.||:||:|.:.....:....:.|.:.|.|:..||...|.:|..:...||||:||.|
pombe   880 KQPTDKILIFSQFVSFLELFTVPFRQEGIKYLMYTGGLSTAERNQALINFEVDPNVRVLLISLKA 944

  Fly   849 GGVGLNLNVANHMLIVDLHWNPQLERQAQDRIYRYGQTKPTFIYRYMCQDTVEQRIKSLQDCKLE 913
            |.|||||..|||::|:|..|||.:|.||.||.:|.||.||..|.|.:..:|:|:|:.:|||.|.|
pombe   945 GNVGLNLTCANHVIILDPFWNPYIEEQAVDRAHRIGQDKPVNILRIVTNNTIEERVLALQDRKRE 1009

  Fly   914 IAKVVLPEEG-GEVTKCVGGGLNLAELKKLFEM 945
            :....|.|:| .|:::     ||..||..||.|
pombe  1010 LIDSALGEKGLREISR-----LNTKELSFLFGM 1037

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10445NP_001246974.1 SNF2_N 212..655 CDD:278600 116/471 (25%)
DEXDc <372..483 CDD:238005 44/128 (34%)
HELICc 761..892 CDD:238034 52/137 (38%)
SPBC23E6.02NP_596602.1 HepA 44..1038 CDD:223627 257/1074 (24%)
DEXDc 410..570 CDD:238005 65/271 (24%)
RING 746..797 CDD:214546 10/51 (20%)
Helicase_C 868..980 CDD:278689 43/112 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 278 1.000 Inparanoid score I669
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45626
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2250
TreeFam 00.000 Not matched by this tool.
44.180

Return to query results.
Submit another query.