DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10445 and rhp16

Sequence 1:NP_001246974.1 Gene:CG10445 FlyBaseID:FBgn0037531 Length:945 Species:Drosophila melanogaster
Sequence 2:NP_587701.1 Gene:rhp16 PomBaseID:SPCC330.01c Length:963 Species:Schizosaccharomyces pombe

Alignment Length:1022 Identity:223/1023 (22%)
Similarity:382/1023 (37%) Gaps:324/1023 (32%)


  Fly    15 QSCSIQDQSSVP---VPDSSGEINNWMEPEPVDSLELSGEYADNESAIFVSASEYNEKKAQIDQL 76
            ||.:...|.|.|   :.|:|....:     ..|::|.      |.:..|.||   .::..:...|
pombe   171 QSNNTSSQHSTPPLSISDTSTHTGS-----STDNVEA------NPNTGFSSA---RKRSLRSSNL 221

  Fly    77 VQKILTMEQQQRQLE------ENASETKELCDLKLHLEKLNARLEALGEFLDTLRLREDQQEIKI 135
            .:|.:.:...:...|      :.:.|...:.|:| ..|..::::| :.|...:.....|::.|.:
pombe   222 KKKFVPLSSPEESNESEFIDDDESDEVASIIDIK-EDETFDSKVE-IPEAAPSSSTESDEESIPL 284

  Fly   136 EDNSELVDHTEQPKWSNLYSGLNRYRQKANHTAAQFYQHKSNIIDS-LKTLYEPIQPRPAIDDL- 198
            ...|:                ..|...:|:.:|:...:.::..|.| .:|.|..|:..|.::.: 
pombe   285 SYQSK----------------RRRVSARASSSASSSSRTQAKSIPSHERTHYRLIRQHPELEHVW 333

  Fly   199 EK-------------QPALLLVRLLKHQQSCLKWMQFRERQKISGGILADDMGLGKTLSMIALIL 250
            ||             ||..|::.||..|:..:.|::.:|.....||||||:||:|||:..|||:|
pombe   334 EKLEEEAPREVKQIEQPKELVLNLLPFQREGVYWLKRQEDSSFGGGILADEMGMGKTIQTIALLL 398

  Fly   251 ASEETKNRKREEKKKALTLKWTQEFNRVYCKEIRKISMFDDEEESGKEEEQYEPPEKRTCHVKTK 315
            :                                         |..||.                 
pombe   399 S-----------------------------------------EPRGKP----------------- 405

  Fly   316 KINQFRILDDDDNDAGDKAVVEDEQKDLLAKTPEPEVFSSDEEEEHLSNGRYPSANTLVVCPMSV 380
                                                                    ||||.|:..
pombe   406 --------------------------------------------------------TLVVAPVVA 414

  Fly   381 MCQWAHEVASKVAQNAIRVLTFHGPNRHEIGIEAFRSYDLVITSYNLV--VNELKRYG------- 436
            :.||..|:.:. ...|:....::|..| :|..|...|||:|:||||::  |...:|.|       
pombe   415 IMQWKEEIDTH-TNKALSTYLYYGQAR-DISGEELSSYDVVLTSYNVIESVYRKERSGFRRKNGV 477

  Fly   437 --NTSPLFAVYWNRVILDEAHIIRNSKTNCCNSVCQLRAHCHWALTGTPVQNRGVDVFALLRFVN 499
              ..|.|..:.:.|:||||||.|::...|...:||.||......|:|||:|||..::|:||||:.
pombe   478 VKEKSLLHQMEFYRIILDEAHGIKSRTCNTARAVCGLRTTRKICLSGTPLQNRIGELFSLLRFLR 542

  Fly   500 VPNF---QDLQ------QW----KKNLNE----------------------------SMLGHRRL 523
            ...|   ..||      .|    :.|.:|                            ..|..:::
pombe   543 ADPFAYYYCLQCECKSLHWRFSDRSNCDECGHKPMSHTCYFNAEMLKPIQKFGYEGPGKLAFKKV 607

  Fly   524 NFIIKPLMLRRTKQKLQASGDMPALPSLKIELICVQLSKTEMAVYQILSAISKKIFTQFLLQREK 588
            :.::|.:|||||  ||:.:.|: .||...:|:.....::.|..|||.|...||:.|..:|.:   
pombe   608 HSLLKHIMLRRT--KLERADDL-GLPPRVVEVRKDLFNEEEEDVYQSLYMDSKRKFNTYLAE--- 666

  Fly   589 GNSDLNYYSLERTPQFIAGHMSDERYNEIYERFLKSLGYNPGEKILGIYILVLLLRLRQFCCHPG 653
             ...||.|:                                       .|..|:.|:||...||.
pombe   667 -GVVLNNYA---------------------------------------NIFQLITRMRQMADHPD 691

  Fly   654 LMIGMLRGALTAEDVQNVKVDASDVEGQLKMDVLAELDKFDETDSEDD------CCDEEDSTRRD 712
            |::...|..:..|:.:|:.....|...|            |..:|...      |..|..:...|
pombe   692 LVLASKRKTVDIENQENIVCKICDEVAQ------------DAIESRCHHTFCRLCVTEYINAAGD 744

  Fly   713 GNFKLEVIKDEIKEENV-------PWDSGDDLPTASSF-EDQLDSARALKLLNPQNPIFQFIRPS 769
            |             |||       |.......|....| |::..:|..|..::..:     .|.|
pombe   745 G-------------ENVNCPSCFIPLSIDLSAPALEDFSEEKFKNASILNRIDMNS-----WRSS 791

  Fly   770 AKLKMVIDKLEELLTGTND---KIIVTSQWVSYLAIVRKRLQDLSWETLDFNGQLTAKEREIVLR 831
            .|::.::::|  .|....|   |.||.||:.|.|.::..||:...:..:..:|.:|.|.|...:.
pombe   792 TKIEALVEEL--YLLRKKDRTLKSIVFSQFTSMLDLIHWRLRKAGFNCVKLDGGMTPKARAATIE 854

  Fly   832 DFNANNEKRVLLLSLTAGGVGLNLNVANHMLIVDLHWNPQLERQAQDRIYRYGQTKPTFIYRYMC 896
            .|:.:....:.|:||.||||.|||..|:.:.::|..||..::.||.|||:|.||.:|..:.....
pombe   855 AFSNDINITIFLVSLKAGGVALNLTEASQVFMMDPWWNGAVQWQAMDRIHRIGQKRPIKVITLCI 919

  Fly   897 QDTVEQRIKSLQDCKLEIAKVVLPEEGGEVTKCVGGGLNLAELKKLF 943
            ::::|.:|..||:.|.::....:.::...:.:     |::.:::.||
pombe   920 ENSIESKIIELQEKKAQMIHATIDQDEKALNQ-----LSVEDMQFLF 961

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10445NP_001246974.1 SNF2_N 212..655 CDD:278600 111/495 (22%)
DEXDc <372..483 CDD:238005 42/122 (34%)
HELICc 761..892 CDD:238034 43/134 (32%)
rhp16NP_587701.1 HepA 27..962 CDD:223627 223/1023 (22%)
DEXDc 378..526 CDD:238005 60/264 (23%)
RING 711..753 CDD:214546 11/67 (16%)
Helicase_C 791..907 CDD:278689 39/118 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T133333
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2250
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.